KEGG   Homo sapiens (human): 2996
Entry
2996              CDS       T01001                                 

Gene name
GYPE, GPE, GYPA, MNS, MiIX
Definition
(RefSeq) glycophorin E (MNS blood group)
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Glycophorin_A DUF3619
Other DBs
NCBI-GeneID: 2996
NCBI-ProteinID: NP_002093
OMIM: 138590
HGNC: 4705
Ensembl: ENSG00000197465
Vega: OTTHUMG00000161402
Pharos: P15421(Tdark)
UniProt: P15421
Position
4q31.21
AA seq 78 aa
MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIF
EVMLVVVGMIILISYCIR
NT seq 237 nt   +upstreamnt  +downstreamnt
atgtatggaaaaataatctttgtattactattgtcaggaattgtgagcatatcagcatca
agtaccactggtgtggcaatgcacacttcaacctcttcttcagtcacaaagagttacatc
tcatcacagacaaatgggataacactcattaattggtgggcgatggctcgtgttattttt
gaggtgatgcttgttgttgttggaatgatcatcttaatttcttactgtattcgatga

DBGET integrated database retrieval system