KEGG   Homo sapiens (human): 29966Help
Entry
29966             CDS       T01001                                 

Gene name
STRN3, PPP2R6B, S/G2NA, SG2NA
Definition
(RefSeq) striatin 3
  KO
K17608  striatin 1/3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    29966 (STRN3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     29966 (STRN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Striatin WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 29966
NCBI-ProteinID: NP_001077362
OMIM: 614766
HGNC: 15720
Ensembl: ENSG00000196792
Vega: OTTHUMG00000140201
Pharos: Q13033(Tbio)
UniProt: Q13033
Structure
PDB: 

Position
14q12
AA seq 797 aa AA seqDB search
MDELAGGGGGGPGMAAPPRQQQGPGGNLGLSPGGNGAAGGGGPPASEGAGPAAGPELSRP
QQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKM
LEYALKQERAKYHKLKYGTELNQGDLKMPTFESEETKDTEAPTAPQNSQLTWKQGRQLLR
QYLQEVGYTDTILDVRSQRVRSLLGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRS
SGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEE
ALKEFDFLVTAEDGEGAGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKERK
GKKGVKRANRTKLYDMIADLGDDELPHIPSGIINQSRSASTRMTDHEGARAEEAEPITFP
SGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHF
DGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEPIYTFRAHIGPVLSLA
ISSNGEQCFSGGIDATIQWWNMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQ
LLSCSADGTVRLWNPQEKLPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYD
LETSQSLVILSSQVDSGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMV
AHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSS
KAYIASAGADALAKVFV
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcttgccggaggcggtggtggcggcccggggatggcggcccctccccggcag
cagcagggacctggggggaacctgggcctttcgcccggggggaacggagcggcgggcggc
gggggtcctccggcctccgagggagcgggtcccgcggcaggccccgagctgtcccggccg
cagcagtacactatcccggggatactgcactacatccagcacgagtgggctcggttcgag
atggagcgggcgcactgggaggtggaacgggccgaactgcaggcccggattgcatttcta
caaggcgaaagaaaaggtcaagagaacctgaagaaggacttagtaagaagaataaagatg
ttagagtatgcattaaaacaagaaagggcaaaatatcacaaattaaaatatggcacggaa
ctgaaccaaggtgacttgaaaatgccaacctttgagtcagaagaaaccaaagacacagag
gctcccacagcacctcagaatagccagttaacgtggaagcaaggcagacagcttttaaga
cagtatcttcaggaagtaggttatacagatacaatattagatgtacggtctcagcgggta
aggtcattacttggactatctaattcagaaccaaatggatcagtagaaacaaagaattta
gaacagatcctgaatggaggtgaatctcctaagcaaaagggacaagaaataaaaaggtcc
tctggtgatgttcttgagacgttcaatttcttagaaaatgccgatgacagtgatgaagat
gaggaaaatgacatgatcgaaggcatcccagaaggaaaagacaaacatcggatgaataaa
cataaaataggtaatgaaggtttagctgctgacctaactgacgatcctgatactgaggaa
gcactgaaagaatttgattttttagtgactgctgaagatggtgaaggagctggagaagca
cggagttcgggggatggcacagaatgggataaagatgacctctccccaactgctgaggtt
tgggatgtagaccagggactaataagtaaactgaaggaacagtacaagaaggaacgaaag
gggaagaaaggggtgaagagggccaacaggacaaaactctacgacatgatagctgatctg
ggagatgatgagctgccccacatcccttcaggaatcattaatcagtctaggtcagcctct
actagaatgactgatcatgaaggtgcaagagcagaggaagctgaaccaataacgtttcca
tctggaggaggcaagtcatttattatgggttctgatgatgttttgttaagtgtactgggc
cttggagaccttgcagacttgacggtaacaaatgatgcagactatagttatgatttgcct
gctaataaagatgcctttcgaaagacatggaatcccaagtatacactacgtagccatttt
gatggagtacgggcattagcttttcatcctgtagaacctgtgctggttactgcttctgag
gaccataccctgaaactttggaacctgcaaaaaacagttcctgccaaaaagagtgcctct
ttagatgtagagcctatctacacatttagggcccacatcggccctgttctgtcattagct
attagttctaatggagaacagtgttttagtggtggtattgatgcaaccatccagtggtgg
aatatgccgagtcccagtgtagatccatatgatacatatgagccaaatgttctagctggc
actttagttggtcatacagatgcagtttggggtcttgcttatagtggcataaaaaatcaa
ttactgtcttgttcagcagatggcactgttaggttatggaatccacaagaaaaattgcca
tgtatttgcacttacaatggagataaaaagcatggaatacctacatcagttgactttata
ggctgtgatccagctcatatggtaacctctttcaacactggtagtgcagtaatttatgat
ttagaaacatcacagtcattggtgatactttcatcacaggtagattctggtttacaatct
aataatcatatcaacagagtagtaagtcatcccacacttcctgttacaataactgctcat
gaagatagacacatcaaattttttgacaataaaacgggtaaaatgatccattctatggta
gctcacttggatgctgttacaagtctagcagtagatcctaatggaatctatttgatgtct
ggaagccatgactgttccatcagattatggaatttagacagcaagacatgtgtgcaagaa
ataacagctcacagaaagaaattggatgaatcaatttatgatgttgctttccactcgtca
aaagcatatatagctagtgcaggagctgatgctcttgccaaagtatttgtatga

DBGET integrated database retrieval system