KEGG   Homo sapiens (human): 29968
Entry
29968             CDS       T01001                                 

Gene name
PSAT1, EPIP, NLS2, PSA, PSAT, PSATD
Definition
(RefSeq) phosphoserine aminotransferase 1
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00270  Cysteine and methionine metabolism
hsa00750  Vitamin B6 metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa01240  Biosynthesis of cofactors
Module
hsa_M00020  Serine biosynthesis, glycerate-3P => serine
Disease
H01082  Phosphoserine aminotransferase deficiency
H02117  Neu-Laxova syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    29968 (PSAT1)
   00270 Cysteine and methionine metabolism
    29968 (PSAT1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    29968 (PSAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    29968 (PSAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     29968 (PSAT1)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class V
   29968 (PSAT1)
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-GeneID: 29968
NCBI-ProteinID: NP_478059
OMIM: 610936
HGNC: 19129
Ensembl: ENSG00000135069
Vega: OTTHUMG00000020066
Pharos: Q9Y617(Tbio)
UniProt: Q9Y617 A0A024R222
Structure
PDB: 
3E77

Position
9q21.2
AA seq 370 aa
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLV
RELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
INIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSN
FLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLY
NTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSK
MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAF
MKKFLEMHQL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggacgcccccaggcaggtggtcaactttgggcctggtcccgccaagctgccgcactca
gtgttgttagagatacaaaaggaattattagactacaaaggagttggcattagtgttctt
gaaatgagtcacaggtcatcagattttgccaagattattaacaatacagagaatcttgtg
cgggaattgctagctgttccagacaactataaggtgatttttctgcaaggaggtgggtgc
ggccagttcagtgctgtccccttaaacctcattggcttgaaagcaggaaggtgtgctgac
tatgtggtgacaggagcttggtcagctaaggccgcagaagaagccaagaagtttgggact
ataaatatcgttcaccctaaacttgggagttatacaaaaattccagatccaagcacctgg
aacctcaacccagatgcctcctacgtgtattattgcgcaaatgagacggtgcatggtgtg
gagtttgactttatacccgatgtcaagggagcagtactggtttgtgacatgtcctcaaac
ttcctgtccaagccagtggatgtttccaagtttggtgtgatttttgctggtgcccagaag
aatgttggctctgctggggtcaccgtggtgattgtccgtgatgacctgctggggtttgcc
ctccgagagtgcccctcggtcctggaatacaaggtgcaggctggaaacagctccttgtac
aacacgcctccatgtttcagcatctacgtcatgggcttggttctggagtggattaaaaac
aatggaggtgccgcggccatggagaagcttagctccatcaaatctcaaacaatttatgag
attattgataattctcaaggattctacgtttgtccagtggagccccaaaatagaagcaag
atgaatattccattccgcattggcaatgccaaaggagatgatgctttagaaaaaagattt
cttgataaagctcttgaactcaatatgttgtccttgaaagggcataggtctgtgggaggc
atccgggcctctctgtataatgctgtcacaattgaagacgttcagaagctggccgccttc
atgaaaaaatttttggagatgcatcagctatga

DBGET integrated database retrieval system