KEGG   Homo sapiens (human): 29978Help
Entry
29978             CDS       T01001                                 

Gene name
UBQLN2, ALS15, CHAP1, DSK2, HRIHFB2157, N4BP4, PLIC2
Definition
(RefSeq) ubiquilin 2
  KO
K04523  ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29978 (UBQLN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29978 (UBQLN2)
   03051 Proteasome [BR:hsa03051]
    29978 (UBQLN2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    29978 (UBQLN2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    29978 (UBQLN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD YukD Rad60-SLD_2 Ubiquitin_5 DUF2407 Atg8 CUE HOIP-UBA
Motif
Other DBs
NCBI-GeneID: 29978
NCBI-ProteinID: NP_038472
OMIM: 300264
HGNC: 12509
Ensembl: ENSG00000188021
Vega: OTTHUMG00000021669
Pharos: Q9UHD9(Tbio)
UniProt: Q9UHD9
Structure
PDB: 

Position
Xp11.21
AA seq 624 aa AA seqDB search
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAG
TNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPE
MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARN
PAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS
SGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYV
ASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGV
GVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSS
AAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREAN
LQALIATGGDINAAIERLLGSQPS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaatggcgagagcagcggccccccgcgcccctcccgcggccctgctgcggcc
caaggctcggctgctgccccggctgagcctaaaatcatcaaagtcacggtgaagactccc
aaagagaaagaggagttcgcggtgcccgagaacagctcggttcagcagtttaaggaagcg
atttcgaaacgcttcaaatcccaaaccgatcagctagtgctgatttttgccggaaaaatc
ttaaaagatcaagataccttgatccagcatggcatccatgatgggctgactgttcacctt
gtcatcaaaagccagaaccgacctcagggccagtccacgcagcctagcaatgccgcggga
actaacactacctcggcgtcgactcccaggagtaactccacacctatttccacaaatagc
aacccgtttgggttggggagcctgggaggacttgcaggccttagcagcctgggcttgagc
tcgaccaacttctctgagctccagagccagatgcagcagcagcttatggccagccctgag
atgatgatccaaataatggaaaatccctttgttcagagcatgctttcgaatcccgatctg
atgaggcagctcattatggctaatccacagatgcagcaattgattcagagaaacccagaa
atcagtcacctgctcaacaacccagacataatgaggcagacactcgaaattgccaggaat
ccagccatgatgcaagagatgatgagaaatcaagacctggctcttagcaatctagaaagc
atcccaggtggctataatgctttacggcgcatgtacactgacattcaagagccgatgctg
aatgccgcacaagagcagtttgggggtaatccatttgcctccgtggggagtagttcctcc
tctggggaaggtacgcagccttcccgcacagaaaatcgcgatccactacccaatccatgg
gcaccaccgccagctacccagagttctgcaactaccagcacgaccacaagcactggtagt
gggtctggcaatagttccagcaatgctactgggaacaccgttgctgccgctaattatgtc
gccagcatctttagtaccccaggcatgcagagcctgctgcaacagataactgaaaacccc
cagctgattcagaatatgctgtcggcgccctacatgagaagcatgatgcagtcgctgagc
cagaatccagatttggctgcacagatgatgctgaatagcccgctgtttactgcaaatcct
cagctgcaggagcagatgcggccacagctcccagccttcctgcagcagatgcagaatcca
gacacactatcagccatgtcaaacccaagagcaatgcaggctttaatgcagatccagcag
gggctacagacattagccactgaagcacctggcctgattccgagcttcactccaggtgtg
ggggtgggggtgctgggaaccgctataggccctgtaggcccagtcacccccataggcccc
ataggccctatagtcccttttacccccataggccccattgggcccataggacccactggc
cctgcagccccccctggctccaccggctctggtggccccacggggcctactgtgtccagc
gctgcacctagtgaaaccacgagtcctacatcagaatctggacccaaccagcagttcatt
cagcaaatggtgcaggccctggctggagcaaatgctccacagctgccgaatccagaagtc
agatttcagcaacaactggaacagctcaacgcaatggggttcttaaaccgtgaagcaaac
ttgcaggccctaatagcaacaggaggcgacatcaatgcagccattgaaaggctgctgggc
tcccagccatcgtaa

DBGET integrated database retrieval system