KEGG   Homo sapiens (human): 29979Help
Entry
29979             CDS       T01001                                 

Gene name
UBQLN1, DA41, DSK2, PLIC-1, UBQN, XDRP1
Definition
(RefSeq) ubiquilin 1
  KO
K04523  ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29979 (UBQLN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29979 (UBQLN1)
   03051 Proteasome [BR:hsa03051]
    29979 (UBQLN1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    29979 (UBQLN1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    29979 (UBQLN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Rad60-SLD_2 YukD Ubiquitin_5 DUF2407 HOIP-UBA CUE Atg8
Motif
Other DBs
NCBI-GeneID: 29979
NCBI-ProteinID: NP_038466
OMIM: 605046
HGNC: 12508
Ensembl: ENSG00000135018
Vega: OTTHUMG00000020104
Pharos: Q9UMX0(Tbio)
UniProt: Q9UMX0
Structure
PDB: 

Position
9q21.32; 9q21.2-q21.3
AA seq 589 aa AA seqDB search
MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQ
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQT
NTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
SNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
PNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN
NPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGL
IPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQL
QNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagtggtgaaagcggcggtcctccgggctcccaggatagcgccgccggagcc
gaaggtgctggcgcccccgcggccgctgcctccgcggagcccaaaatcatgaaagtcacc
gtgaagaccccgaaggaaaaggaggaattcgccgtgcccgagaatagctccgtccagcag
tttaaggaagaaatctctaaacgttttaaatcacatactgaccaacttgtgttgatattt
gctggaaaaattttgaaagatcaagataccttgagtcagcatggaattcatgatggactt
actgttcaccttgtcattaaaacacaaaacaggcctcaggatcattcagctcagcaaaca
aatacagctggaagcaatgttactacatcatcaactcctaatagtaactctacatctggt
tctgctactagcaacccttttggtttaggtggccttgggggacttgcaggtctgagtagc
ttgggtttgaatactaccaacttctctgaactacagagtcagatgcagcgacaacttttg
tctaaccctgaaatgatggtccagatcatggaaaatccctttgttcagagcatgctctca
aatcctgacctgatgagacagttaattatggccaatccacaaatgcagcagttgatacag
agaaatccagaaattagtcatatgttgaataatccagatataatgagacaaacgttggaa
cttgccaggaatccagcaatgatgcaggagatgatgaggaaccaggaccgagctttgagc
aacctagaaagcatcccagggggatataatgctttaaggcgcatgtacacagatattcag
gaaccaatgctgagtgctgcacaagagcagtttggtggtaatccatttgcttccttggtg
agcaatacatcctctggtgaaggtagtcaaccttcccgtacagaaaatagagatccacta
cccaatccatgggctccacagacttcccagagttcatcagcttccagcggcactgccagc
actgtgggtggcactactggtagtactgccagtggcacttctgggcagagtactactgcg
ccaaatttggtgcctggagtaggagctagtatgttcaacacaccaggaatgcagagcttg
ttgcaacaaataactgaaaacccacaactgatgcaaaacatgttgtctgccccctacatg
agaagcatgatgcagtcactaagccagaatcctgaccttgctgcacagatgatgctgaat
aatcccctatttgctggaaatcctcagcttcaagaacaaatgagacaacagctcccaact
ttcctccaacaaatgcagaatcctgatacactatcagcaatgtcaaaccctagagcaatg
caggccttgttacagattcagcagggtttacagacattagcaacggaagccccgggcctc
atcccagggtttactcctggcttgggggcattaggaagcactggaggctcttcgggaact
aatggatctaacgccacacctagtgaaaacacaagtcccacagcaggaaccactgaacct
ggacatcagcagtttattcagcagatgctgcaggctcttgctggagtaaatcctcagcta
cagaatccagaagtcagatttcagcaacaactggaacaactcagtgcaatgggatttttg
aaccgtgaagcaaacttgcaagctctaatagcaacaggaggtgatatcaatgcagctatt
gaaaggttactgggctcccagccatcatag

DBGET integrated database retrieval system