KEGG   Homo sapiens (human): 29988
Entry
29988             CDS       T01001                                 

Gene name
SLC2A8, GLUT8, GLUTX1
Definition
(RefSeq) solute carrier family 2 member 8
  KO
K08145  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    29988 (SLC2A8)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   29988 (SLC2A8)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    29988 (SLC2A8)
SSDB
Motif
Pfam: Sugar_tr MFS_1 RskA
Other DBs
NCBI-GeneID: 29988
NCBI-ProteinID: NP_055395
OMIM: 605245
HGNC: 13812
Ensembl: ENSG00000136856
Vega: OTTHUMG00000020702
Pharos: Q9NY64(Tbio)
UniProt: Q9NY64 Q8WZ05 A0A024R871
Position
9q33.3
AA seq 477 aa
MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPP
APRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDV
WMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLE
WRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAE
QSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGV
IQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVS
AQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLM
AFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgacgcccgaggacccagaggaaacccagccgcttctggggcctcctggcggcagcgcg
ccccgcggccgccgcgtcttcctcgccgccttcgccgctgccctgggcccactcagcttc
ggcttcgcgctcggctacagctccccggccatccctagcctgcagcgcgccgcgcccccg
gccccgcgcctggacgacgccgccgcctcctggttcggggctgtcgtgaccctgggtgcc
gcggcggggggagtgctgggcggctggctggtggaccgcgccgggcgcaagctgagcctc
ttgctgtgctccgtgcccttcgtggccggctttgccgtcatcaccgcggcccaggacgtg
tggatgctgctggggggccgcctcctcaccggcctggcctgcggtgttgcctccctagtg
gccccggtctacatctccgaaatcgcctacccagcagtccgggggttgctcggctcctgt
gtgcagctaatggtcgtcgtcggcatcctcctggcctacctggcaggctgggtgctggag
tggcgctggctggctgtgctgggctgcgtgcccccctccctcatgctgcttctcatgtgc
ttcatgcccgagaccccgcgcttcctgctgactcagcacaggcgccaggaggccatggcc
gccctgcggttcctgtggggctccgagcagggctgggaagacccccccatcggggctgag
cagagctttcacctggccctgctgcggcagcccggcatctacaagcccttcatcatcggc
gtctccctgatggccttccagcagctgtcgggggtcaacgccgtcatgttctatgcagag
accatctttgaagaggccaagttcaaggacagcagcctggcctcggtcgtcgtgggtgtc
atccaggtgctgttcacagctgtggcggctctcatcatggacagagcagggcggaggctg
ctcctggtcttgtcaggtgtggtcatggtgttcagcacgagtgccttcggcgcctacttc
aagctgacccagggtggccctggcaactcctcgcacgtggccatctcggcgcctgtctct
gcacagcctgttgatgccagcgtggggctggcctggctggccgtgggcagcatgtgcctc
ttcatcgccggctttgcggtgggctgggggcccatcccctggctcctcatgtcagagatc
ttccctctgcatgtcaagggcgtggcgacaggcatctgcgtcctcaccaactggctcatg
gcctttctcgtgaccaaggagttcagcagcctcatggaggtcctcaggccctatggagcc
ttctggcttgcctccgctttctgcatcttcagtgtccttttcactttgttctgtgtccct
gaaactaaaggaaagactctggaacaaatcacagcccattttgaggggcgatga

DBGET integrated database retrieval system