KEGG   Homo sapiens (human): 29999
Entry
29999             CDS       T01001                                 
Symbol
FSCN3
Name
(RefSeq) fascin actin-bundling protein 3
  KO
K17456  fascin 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    29999 (FSCN3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     29999 (FSCN3)
SSDB
Motif
Pfam: Fascin FRG1 DUF569 FGF
Other DBs
NCBI-GeneID: 29999
NCBI-ProteinID: NP_065102
OMIM: 615800
HGNC: 3961
Ensembl: ENSG00000106328
Pharos: Q9NQT6(Tdark)
UniProt: Q9NQT6 A0A140VK18
Position
7:127593736..127602144
AA seq 498 aa
MDETEWIHRHPKAEDLRVGLISWAGTYLTFEACKNTVTATAKSLGRRQTWEILVSNEHET
QAVVRLKSVQGLYLLCECDGTVCYGRPRTSHHGCFLLRFHRNSKWTLQCLISGRYLESNG
KDVFCTSHVLSAYHMWTPRPALHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGF
LLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLVALCDGEGGMLYPQGT
HLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFE
CDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGI
APNSLLMANVILPGPNEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLL
PCRPGIYHFQAQGGSFWSITSFGTFRPWGKFALNFCIELQGSNLLTVLAPNGFYMRADQS
GTLLADSEDITRECIWEF
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggatgagacagagtggatacacagacatcccaaggctgaggacctaagggttgggctc
atcagctgggcaggaacctacctcacctttgaggcatgcaagaatacagtcactgcaact
gcgaagagtttgggcaggagacagacctgggagatcttggtgagcaatgagcatgagaca
caggccgtggtgcgactaaagagcgtgcagggcctctacctgctgtgtgagtgtgatggc
accgtgtgttatggccgcccaaggaccagccaccatgggtgctttctactgcgtttccac
cggaacagcaagtggaccctccagtgcctaatctctggtcgttatttggagtccaatggc
aaggacgtgttttgcacttcccacgtcctctcagcttaccacatgtggaccccccgacca
gccctccatgtccacgtgatcctctacagccccatccaccgctgctatgcccgggctgac
cccactatgggccgcatctgggtggacgcagcagttccctgcctggaggagtgtggcttc
ctgttgcatttccgagatggatgctaccacctggagacctctacacaccacttcttgtcc
catgtagaccggctgttctcccaaccctcatcacagacagcttttcacatgcaagtgcgg
cctggagggcttgtggcactgtgtgatggagaaggaggcatgttatatccacagggcacg
catctgctcttgggcatgggctgcaaccccatgaggggtgaggagtggttcatcctacag
cactgcccaacctgggtcagcctcaggtcaaagactgggcggttcatctcagtcatctac
gatggtgaggtgcgtgctgcttctgagcgcttaaaccgaatgtccttgttccagtttgaa
tgtgacagtgagagccccactgtgcagcttcgttcagccaatggctactacctatcccag
aggcgccacagggcagtaatggctgatgggcaccccctggagtctgacacgttcttccga
atgcactggaactgtggcaggatcatcctgcagtcctgcagggggcgcttcctgggcatt
gcacccaacagcctgctgatggccaatgtcatccttccaggcccaaatgaggaatttggg
attttatttgccaatcgctccttccttgtattgcgaggtcgttatggctatgtgggctcc
tcatcgggccatgacctcatacagtgcaaccaggatcagcccgaccgcattcatctacta
ccctgccgaccgggtatctaccacttccaggcacaggggggatccttctggtcaataaca
tcctttggcacctttcgcccttggggcaagtttgccctcaacttctgtatcgagcttcag
gggagcaacttactcactgtactggcccccaatggcttctacatgcgagccgaccaaagt
ggcaccctgttggcagacagtgaagacattaccagagagtgtatctgggaattttag

DBGET integrated database retrieval system