KEGG   Homo sapiens (human): 30Help
Entry
30                CDS       T01001                                 

Gene name
ACAA1, ACAA, PTHIO, THIO
Definition
(RefSeq) acetyl-CoA acyltransferase 1
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00592  alpha-Linolenic acid metabolism
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
Module
hsa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    30 (ACAA1)
   00592 alpha-Linolenic acid metabolism
    30 (ACAA1)
   01040 Biosynthesis of unsaturated fatty acids
    30 (ACAA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    30 (ACAA1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    30 (ACAA1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    30 (ACAA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     30 (ACAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 30
NCBI-ProteinID: NP_001598
OMIM: 604054
HGNC: 82
Ensembl: ENSG00000060971
Vega: OTTHUMG00000131087
Pharos: P09110(Tbio)
UniProt: P09110 A0A024R2M6
Structure
PDB: 

Position
3p22.2
AA seq 424 aa AA seqDB search
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTT
PDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVN
RQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIP
MGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSI
TVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPI
LGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLR
LPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE
YPGN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggctgcaggtagtgctgggccacctgaggggtccggccgattccggctggatg
ccgcaggccgcgccttgcctgagcggtgccccgcaggcctcggccgcggacgtggtggtg
gtgcacgggcggcgcacggccatctgccgggcgggccgcggcggcttcaaggacaccacc
cccgacgagcttctctcggcagtcatgaccgcggttctcaaggacgtgaatctgaggccg
gaacagctgggggacatctgtgtcggaaatgtgctgcagcctggggccggggcaatcatg
gcccgaatcgcccagtttctgagtgacatcccggagactgtgcctttgtccactgtcaat
agacagtgttcgtcggggctacaggcagtggccagcatagcaggtggcatcagaaatggg
tcttatgacattggcatggcctgtggggtggagtccatgtccctggctgacagagggaac
cctggaaatattacttcgcgcttgatggagaaggagaaggccagagattgcctgattcct
atggggataacctctgagaatgtggctgagcggtttggcatttcacgggagaagcaggat
acctttgccctggcttcccagcagaaggcagcaagagcccagagcaagggctgtttccaa
gctgagattgtgcctgtgaccaccacggtccatgatgacaagggcaccaagaggagcatc
actgtgacccaggatgagggtatccgccccagcaccaccatggagggcctggccaaactg
aagcctgccttcaagaaagatggttctaccacagctggaaactctagccaggtgagtgat
ggggcagctgccatcctgctggcccggaggtccaaggcagaagagttgggccttcccatc
cttggggtcctgaggtcttatgcagtggttggggtcccacctgacatcatgggcattgga
cctgcctatgccatcccagtagctttgcaaaaagcagggctgacagtgagtgacgtggac
atcttcgagatcaatgaggcctttgcaagccaggctgcctactgtgtggagaagctacga
ctcccccctgagaaggtgaaccccctggggggtgcagtggccttagggcacccactgggc
tgcactggggcacgacaggtcatcacgctgctcaatgagctgaagcgccgtgggaagagg
gcatacggagtggtgtccatgtgcatcgggactggaatgggagccgctgccgtctttgaa
taccctgggaactga

DBGET integrated database retrieval system