KEGG   Homo sapiens (human): 30001
Entry
30001             CDS       T01001                                 

Symbol
ERO1A, ERO1-L, ERO1-L-alpha, ERO1-alpha, ERO1L, ERO1LA, Ero1alpha
Name
(RefSeq) endoplasmic reticulum oxidoreductase 1 alpha
  KO
K10950  ERO1-like protein alpha [EC:1.8.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05110  Vibrio cholerae infection
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    30001 (ERO1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    30001 (ERO1A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    30001 (ERO1A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     30001 (ERO1A)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 30001
NCBI-ProteinID: NP_055399
OMIM: 615435
HGNC: 13280
Ensembl: ENSG00000197930
Vega: OTTHUMG00000140301
Pharos: Q96HE7(Tbio)
UniProt: Q96HE7
Structure
PDB: 
3AHQ 3AHR

Position
14q22.1
AA seq 468 aa
MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYR
LFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKY
SEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVD
LLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGL
CVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRR
LKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDE
NSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKL
IANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgggccgcggctggggattcttgtttggcctcctgggcgccgtgtggctgctcagctcg
ggccacggagaggagcagcccccggagacagcggcacagaggtgcttctgccaggttagt
ggttacttggatgattgtacctgtgatgttgaaaccattgatagatttaataactacagg
cttttcccaagactacaaaaacttcttgaaagtgactactttaggtattacaaggtaaac
ctgaagaggccgtgtcctttctggaatgacatcagccagtgtggaagaagggactgtgct
gtcaaaccatgtcaatctgatgaagttcctgatggaattaaatctgcgagctacaagtat
tctgaagaagccaataatctcattgaagaatgtgaacaagctgaacgacttggagcagtg
gatgaatctctgagtgaggaaacacagaaggctgttcttcagtggaccaagcatgatgat
tcttcagataacttctgtgaagctgatgacattcagtcccctgaagctgaatatgtagat
ttgcttcttaatcctgagcgctacactggttacaagggaccagatgcttggaaaatatgg
aatgtcatctacgaagaaaactgttttaagccacagacaattaaaagacctttaaatcct
ttggcttctggtcaagggacaagtgaagagaacactttttacagttggctagaaggtctc
tgtgtagaaaaaagagcattctacagacttatatctggcctacatgcaagcattaatgtg
catttgagtgcaagatatcttttacaagagacctggttagaaaagaaatggggacacaac
attacagaatttcaacagcgatttgatggaattttgactgaaggagaaggtccaagaagg
cttaagaacttgtattttctctacttaatagaactaagggctttatccaaagtgttacca
ttcttcgagcgcccagattttcaactctttactggaaataaaattcaggatgaggaaaac
aaaatgttacttctggaaatacttcatgaaatcaagtcatttcctttgcattttgatgag
aattcattttttgctggggataaaaaagaagcacacaaactaaaggaggactttcgactg
cattttagaaatatttcaagaattatggattgtgttggttgttttaaatgtcgtctgtgg
ggaaagcttcagactcagggtttgggcactgctctgaagatcttattttctgagaaattg
atagcaaatatgccagaaagtggacctagttatgaattccatctaaccagacaagaaata
gtatcattattcaacgcatttggaagaatttctacaagtgtgaaagaattagaaaacttc
aggaacttgttacagaatattcattaa

KEGG   Homo sapiens (human): 56605
Entry
56605             CDS       T01001                                 

Symbol
ERO1B, ERO1LB, Ero1beta
Name
(RefSeq) endoplasmic reticulum oxidoreductase 1 beta
  KO
K10976  ERO1-like protein beta [EC:1.8.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56605 (ERO1B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     56605 (ERO1B)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 56605
NCBI-ProteinID: NP_063944
OMIM: 615437
HGNC: 14355
Ensembl: ENSG00000086619
Vega: OTTHUMG00000039955
Pharos: Q86YB8(Tbio)
UniProt: Q86YB8
Position
1q42.3
AA seq 467 aa
MSQGVRRAGAGQGVAAAVQLLVTLSFLRSVVEAQVTGVLDDCLCDIDSIDNFNTYKIFPK
IKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKM
ANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDSRDHFCELDDERSPAAQYVDL
LLNPERYTGYKGTSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLC
LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFKHRFDPVETKGEGPRRL
KNLYFLYLIELRALSKVAPYFERSIVDLYTGNAEEDADTKTLLLNIFQDTKSFPMHFDEK
SMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEI
QKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRDLQNFKVLLQHSR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgagccaaggggtccgccgggcaggcgctgggcagggggtagcggccgcggtgcagctg
ctggtcaccctgagcttcctgcggagcgtcgtcgaggcgcaggtcactggagttctggat
gattgcttgtgtgatattgacagcatcgataacttcaatacctacaaaatcttccccaaa
ataaaaaaattgcaagagagagactattttcgttattacaaggttaatctgaagcgacct
tgtcctttctgggcagaagatggccactgttcaataaaagactgtcatgtggagccctgt
ccagagagtaaaattccggttggaataaaagctgggcattctaataagtacttgaaaatg
gcaaacaataccaaagaattagaagattgtgagcaagctaataaactgggagcaattaac
agcacattaagtaatcaaagcaaagaagctttcattgactgggcaagatatgatgattca
cgggatcacttttgtgaacttgatgatgagagatctccagctgctcagtatgtagaccta
ttgctgaacccagagcgttacactggctataaagggacctctgcatggagagtgtggaac
agcatctatgaagagaactgtttcaagcctcgatctgtttatcgtcctttaaatcctctg
gcgcctagccgaggcgaagatgatggagaatcattctacacatggctagaaggtttgtgt
ctggagaaaagagtcttctataagcttatatcgggacttcatgctagcatcaatttacat
ctatgcgcaaattatcttttggaagaaacctggggtaagcccagttggggacctaatatt
aaagaattcaaacaccgctttgaccctgtggaaaccaagggagaaggtccaagaaggctc
aagaatctttactttttatacttgattgagcttcgagctttgtcaaaggtggctccatat
tttgagcgctcaattgtcgatctttacactggaaatgcagaagaagatgctgacacaaaa
actcttctactgaatatctttcaagatacaaagtcctttcccatgcactttgatgagaaa
tccatgtttgcaggtgacaaaaaaggggccaagtcactaaaggaggaattccgattacat
ttcaagaatatctcccgtataatggactgtgttggatgtgacaaatgcagattatgggga
aaattacagactcagggtttaggaactgccctgaagatattattctctgaaaaagaaatc
caaaagcttccagagaatagtccatctaaaggcttccaactcacccgacaggaaatagtt
gctcttttaaatgcttttggaaggctttctacaagtataagagacttacagaattttaaa
gtcttattacaacacagtaggtaa

DBGET integrated database retrieval system