KEGG   Homo sapiens (human): 30011Help
Entry
30011             CDS       T01001                                 

Gene name
SH3KBP1, CD2BP3, CIN85, GIG10, HSB-1, HSB1, MIG18
Definition
(RefSeq) SH3 domain containing kinase binding protein 1
  KO
K12470  SH3 domain-containing kinase-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    30011 (SH3KBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    30011 (SH3KBP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    30011 (SH3KBP1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    30011 (SH3KBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2 Tmemb_cc2
Motif
Other DBs
NCBI-GeneID: 30011
NCBI-ProteinID: NP_114098
OMIM: 300374
HGNC: 13867
Ensembl: ENSG00000147010
Vega: OTTHUMG00000021227
Pharos: Q96B97(Tbio)
UniProt: Q96B97 Q5JPT6
Structure
PDB: 

Position
Xp22.12
AA seq 665 aa AA seqDB search
MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEM
KKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELK
VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTG
SESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV
EKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD
CIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHE
IKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPT
TSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTIS
QVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKME
PAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKK
ALQSK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggccatagtggagtttgactaccaggcccagcacgatgatgagctgacgatc
agcgtgggtgaaatcatcaccaacatcaggaaggaggatggaggctggtgggagggacag
atcaacggcaggagaggtttgttccctgacaactttgtaagagaaataaagaaagagatg
aagaaagaccctctcaccaacaaagctccagaaaagcccctgcacgaagtgcccagtgga
aactctttgctgtcttctgaaacgattttaagaaccaataagagaggcgagcgacggagg
cgccggtgccaggtggcattcagctacctgccccagaatgacgatgaacttgagctgaaa
gttggcgacatcatagaggtggtaggagaggtagaggaaggatggtgggaaggtgttctc
aacgggaagactggaatgtttccttccaacttcatcaaggagctgtcaggggagtcggat
gagcttggcatttcccaggatgagcagctatccaagtcaagtttaagggaaaccacaggc
tccgagagtgatgggggtgactcaagcagcaccaagtctgaaggtgccaacgggacagtg
gcaactgcagcaatccagcccaagaaagttaagggagtgggctttggagacattttcaaa
gacaagccaatcaaactaagaccaaggtcaattgaagtagaaaatgactttctgccggta
gaaaagactattgggaagaagttacctgcaactacagcaactccagactcatcaaaaaca
gaaatggacagcaggacaaagagcaaggattactgcaaagtaatatttccatatgaggca
cagaatgatgatgaattgacaatcaaagaaggagatatagtcactctcatcaataaggac
tgcatcgacgtaggctggtgggaaggagagctgaacggcagacgaggcgtgttccccgat
aacttcgtgaagttacttccaccggactttgaaaaggaagggaatagacccaagaagcca
ccgcctccatccgctcctgtcatcaaacaaggggcaggcaccactgagagaaaacatgaa
attaaaaagatacctcctgaaagaccagaaatgcttccaaacagaacagaagaaaaagaa
agaccagagagagagccaaaactggatttacagaagccctccgttcctgccataccgcca
aaaaagcctcggccacctaagaccaattctctcagcagacctggcgcactgcccccgaga
aggccggagagaccggtgggtccgctgacacacaccaggggtgacagtccaaagattgac
ttggccggcagttcgctatctggcatcctggacaaagatctctcggaccgcagcaatgac
attgacttagaaggttttgactccgtggtatcatctactgagaaactcagtcatccgacc
acaagcagaccaaaagctacagggaggcggcctccgtcccagtccctcacatcttcatcc
ctttcaagccctgatatcttcgactccccaagtcccgaagaggataaggaggaacacatt
tcacttgcgcacagaggagtggacgcgtcaaagaaaacttccaagactgttaccatatcc
caagtgtctgacaacaaagcatccctgccgcccaagccggggaccatggcagcaggtggc
ggtgggccagcccctctgtcctcagcggcgccctcccccctgtcatcctctttgggaaca
gctggacacagagccaactccccgtctctgttcggcacggaaggaaaaccaaagatggag
cctgcggccagcagccaggcggccgtggaggagctaaggacacaggtccgcgagctgagg
agcatcatcgagaccatgaaggaccagcagaaacgagagattaaacagttattgtctgag
ttggatgaagagaagaaaatccggcttcggttgcagatggaagtgaacgacataaagaaa
gctctacaatcaaaatga

DBGET integrated database retrieval system