KEGG   Homo sapiens (human): 3002Help
Entry
3002              CDS       T01001                                 

Gene name
GZMB, C11, CCPI, CGL-1, CGL1, CSP-B, CSPB, CTLA1, CTSGL1, HLP, SECT
Definition
(RefSeq) granzyme B
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05202  Transcriptional misregulation in cancer
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
Network
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    3002 (GZMB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3002 (GZMB)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3002 (GZMB)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3002 (GZMB)
   05330 Allograft rejection
    3002 (GZMB)
   05332 Graft-versus-host disease
    3002 (GZMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3002 (GZMB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3002 (GZMB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     3002 (GZMB)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   3002 (GZMB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 3002
NCBI-ProteinID: NP_004122
OMIM: 123910
HGNC: 4709
Ensembl: ENSG00000100453
Vega: OTTHUMG00000029369
Pharos: P10144(Tchem)
UniProt: P10144 Q67BC3
Structure
PDB: 

Position
14q12
AA seq 247 aa AA seqDB search
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL
TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY
YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaatcctgcttctgctggccttcctcctgctgcccagggcagatgcaggggag
atcatcgggggacatgaggccaagccccactcccgcccctacatggcttatcttatgatc
tgggatcagaagtctctgaagaggtgcggtggcttcctgatacgagacgacttcgtgctg
acagctgctcactgttggggaagctccataaatgtcaccttgggggcccacaatatcaaa
gaacaggagccgacccagcagtttatccctgtgaaaagacccatcccccatccagcctat
aatcctaagaacttctccaacgacatcatgctactgcagctggagagaaaggccaagcgg
accagagctgtgcagcccctcaggctacctagcaacaaggcccaggtgaagccagggcag
acatgcagtgtggccggctgggggcagacggcccccctgggaaaacactcacacacacta
caagaggtgaagatgacagtgcaggaagatcgaaagtgcgaatctgacttacgccattat
tacgacagtaccattgagttgtgcgtgggggacccagagattaaaaagacttcctttaag
ggggactctggaggccctcttgtgtgtaacaaggtggcccagggcattgtctcctatgga
cgaaacaatggcatgcctccacgagcctgcaccaaagtctcaagctttgtacactggata
aagaaaaccatgaaacgctactaa

DBGET integrated database retrieval system