KEGG   Homo sapiens (human): 3005Help
Entry
3005              CDS       T01001                                 

Gene name
H1-0, H1.0, H10, H1F0, H1FV
Definition
(RefSeq) H1.0 linker histone
  KO
K11275  histone H1/5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3005 (H1-0)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3005 (H1-0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Linker_histone Forkhead
Motif
Other DBs
NCBI-GeneID: 3005
NCBI-ProteinID: NP_005309
OMIM: 142708
HGNC: 4714
Ensembl: ENSG00000189060
Vega: OTTHUMG00000150659
Pharos: P07305(Tbio)
UniProt: P07305
Structure
PDB: 

Position
22q13.1
AA seq 194 aa AA seqDB search
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATP
KKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVK
PKAKSSAKRAGKKK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaattccacgtccgcccctgcggccaagcccaagcgggccaaggcctccaag
aagtccacagaccaccccaagtattcagacatgatcgtggctgccatccaggccgagaag
aaccgcgctggctcctcgcgccagtccattcagaagtatatcaagagccactacaaggtg
ggtgagaacgctgactcgcagatcaagttgtccatcaagcgcctggtcaccaccggtgtc
ctcaagcagaccaaaggggtgggggcctcggggtccttccggctagccaagagcgacgaa
cccaagaagtcagtggccttcaagaagaccaagaaggaaatcaagaaggtagccacgcca
aagaaggcatccaagcccaagaaggctgcctccaaagccccaaccaagaaacccaaagcc
accccggtcaagaaggccaagaagaagctggctgccacgcccaagaaagccaaaaaaccc
aagactgtcaaagccaagccggtcaaggcatccaagcccaaaaaggccaaaccagtgaaa
cccaaagcaaagtccagtgccaagagggccggcaagaagaagtga

DBGET integrated database retrieval system