KEGG   Homo sapiens (human): 30062
Entry
30062             CDS       T01001                                 

Gene name
RAX, MCOP3, RX
Definition
(RefSeq) retina and anterior neural fold homeobox
  KO
K09332  retina and anterior neural fold homeobox protein
Organism
hsa  Homo sapiens (human)
Disease
H01027  Microphthalmia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    30062 (RAX)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    30062 (RAX)
SSDB
Motif
Pfam: Homeodomain OAR
Other DBs
NCBI-GeneID: 30062
NCBI-ProteinID: NP_038463
OMIM: 601881
HGNC: 18662
Ensembl: ENSG00000134438
Vega: OTTHUMG00000132757
Pharos: Q9Y2V3(Tbio)
UniProt: Q9Y2V3
Position
18q21.32
AA seq 346 aa
MHLPGCAPAMADGSFSLAGHLLRSPGGSTSRLHSIEAILGFTKDDGILGTFPAERGARGA
KERDRRLGARPACPKAPEEGSEPSPPPAPAPAPEYEAPRPYCPKEPGEARPSPGLPVGPA
TGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRV
QVWFQNRRAKWRRQEKLEVSSMKLQDSPLLSFSRSPPSATLSPLGAGPGSGGGPAGGALP
LESWLGPPLPGGGATALQSLPGFGPPAQSLPASYTPPPPPPPFLNSPPLGPGLQPLAPPP
PSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGKPWQAL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgcacctgccgggctgcgcgccagccatggccgacgggagcttctcgcttgccggccac
ctgctccgcagcccgggcgggagcacctcgcgacttcacagcatcgaggccatcctgggg
tttaccaaggacgacgggatcctcggcaccttcccggcggagcggggcgcccggggcgcg
aaggagcgggataggaggctgggcgcgcggcccgcctgccccaaggcgcccgaggaaggc
tccgagccctccccgccgccagccccggcgcccgcccccgagtacgaagcccctcgaccc
tactgccccaaggagcccggggaggcacggccgagcccagggctgcccgtcgggccagcc
accggcgaagcgaaactgtcagaggaggaacagcccaagaaaaagcatcggcggaaccgc
acgactttcaccacgtaccagctgcatgagctggagcgcgcgttcgagaagtcccactac
ccggacgtgtacagccgcgaggagctggccggcaaggtcaacctaccagaggtccgggtc
caggtgtggttccagaaccgacgggctaagtggcggcggcaggagaagctggaagtgtcc
tccatgaagctgcaggactcgcccctcctctccttcagccgctccccgccctccgcgacg
ctgtcgcccctcggggcgggcccgggcagcggtggcgggccggctgggggcgcgctgccg
ctggagtcctggctcgggccgccgctgccgggcgggggcgccacggcgctgcagagcctg
ccgggcttcgggccgccggcgcagagcctgcctgccagctacacgccaccgccgccgcct
ccgcccttcctgaactccccgccgttgggccccggcctgcaacctctcgcgccgccgccg
ccctcctacccgtgcgggcccggcttcggggacaagttcccgctggacgaggcggacccg
cgcaacagcagcatcgcggcgctgcgtctgaaagccaaggagcacatccaggccatcggg
aagccgtggcaggccctctag

DBGET integrated database retrieval system