KEGG   Homo sapiens (human): 3014Help
Entry
3014              CDS       T01001                                 

Gene name
H2AFX, H2A.X, H2A/X, H2AX
Definition
(RefSeq) H2A histone family member X
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3014 (H2AFX)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    3014 (H2AFX)
  09165 Substance dependence
   05034 Alcoholism
    3014 (H2AFX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3014 (H2AFX)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3014 (H2AFX)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    3014 (H2AFX)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3014 (H2AFX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3014
NCBI-ProteinID: NP_002096
OMIM: 601772
HGNC: 4739
Ensembl: ENSG00000188486
Vega: OTTHUMG00000166196
Pharos: P16104(Tbio)
UniProt: P16104
Position
11q23.3
AA seq 143 aa AA seqDB search
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccgcggcaagactggcggcaaggcccgcgccaaggccaagtcgcgctcgtcg
cgcgccggcctccagttcccagtgggccgtgtacaccggctgctgcggaagggccactac
gccgagcgcgttggcgccggcgcgccagtgtacctggcggcagtgctggagtacctcacc
gctgagatcctggagctggcgggcaatgcggcccgcgacaacaagaagacgcgaatcatc
ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc
gtgacgatcgcccagggaggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accagcgccaccgtggggccgaaggcgccctcgggcggcaagaaggccacccaggcctcc
caggagtactaa

DBGET integrated database retrieval system