KEGG   Homo sapiens (human): 3015Help
Entry
3015              CDS       T01001                                 

Gene name
H2AZ1, H2A.Z-1, H2A.z, H2A/z, H2AFZ, H2AZ
Definition
(RefSeq) H2A.Z variant histone 1
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3015 (H2AZ1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3015 (H2AZ1)
  09165 Substance dependence
   05034 Alcoholism
    3015 (H2AZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3015 (H2AZ1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3015 (H2AZ1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3015 (H2AZ1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3015 (H2AZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3015
NCBI-ProteinID: NP_002097
OMIM: 142763
HGNC: 4741
Ensembl: ENSG00000164032
Vega: OTTHUMG00000131048
Pharos: P0C0S5(Tbio)
UniProt: P0C0S5
Structure
PDB: 

Position
4q23
AA seq 128 aa AA seqDB search
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc
tcgcagagagccggcttgcagttcccagtgggccgtattcatcgacacctaaaatctagg
acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgaactggcaggaaatgcatcaaaagacttaaaggtaaag
cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggattctctc
atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg
aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system