KEGG   Homo sapiens (human): 3015Help
Entry
3015              CDS       T01001                                 

Gene name
H2AFZ, H2A.Z-1, H2A.z, H2A/z, H2AZ
Definition
(RefSeq) H2A histone family member Z
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3015 (H2AFZ)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    3015 (H2AFZ)
  Substance dependence
   05034 Alcoholism
    3015 (H2AFZ)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    3015 (H2AFZ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3015 (H2AFZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3015
NCBI-ProteinID: NP_002097
OMIM: 142763
HGNC: 4741
Ensembl: ENSG00000164032
Vega: OTTHUMG00000131048
Pharos: P0C0S5(Tbio)
UniProt: P0C0S5
Structure
PDB: 

Position
4q23
AA seq 128 aa AA seqDB search
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc
tcgcagagagccggcttgcagttcccagtgggccgtattcatcgacacctaaaatctagg
acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgaactggcaggaaatgcatcaaaagacttaaaggtaaag
cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggattctctc
atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg
aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system