KEGG   Homo sapiens (human): 3018
Entry
3018              CDS       T01001                                 

Gene name
H2BC3, H2B.1, H2B/f, H2BFF, HIST1H2BB
Definition
(RefSeq) H2B clustered histone 3
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3018 (H2BC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3018 (H2BC3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3018 (H2BC3)
  09165 Substance dependence
   05034 Alcoholism
    3018 (H2BC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3018 (H2BC3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3018 (H2BC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3018 (H2BC3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3018 (H2BC3)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 3018
NCBI-ProteinID: NP_066406
OMIM: 602803
HGNC: 4751
Ensembl: ENSG00000276410
Vega: OTTHUMG00000014421
Pharos: P33778(Tdark)
UniProt: P33778
Structure
PDB: 
3X1S 3X1U

Position
6p22.2
AA seq 126 aa
MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaaccctctaagtctgctccagcccctaaaaagggttctaagaaggctatcact
aaggcgcagaagaaggatggtaagaagcgtaagcgcagccgcaaggagagctattctatc
tatgtgtacaaggttctgaagcaggtccaccccgacaccggcatctcatccaaggccatg
gggatcatgaattccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcttctcgc
ctggctcactacaataagcgctcgaccatcacctccagggagattcagacggctgtgcgc
ctgctgctgcctggggagctggctaagcatgctgtgtccgagggcactaaggcagttacc
aagtacactagctctaaataa

DBGET integrated database retrieval system