KEGG   Homo sapiens (human): 302Help
Entry
302               CDS       T01001                                 

Gene name
ANXA2, ANX2, ANX2L4, CAL1H, HEL-S-270, LIP2, LPC2, LPC2D, P36, PAP-IV
Definition
(RefSeq) annexin A2
  KO
K17092  annexin A2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    302 (ANXA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    302 (ANXA2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    302 (ANXA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   302 (ANXA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 302
NCBI-ProteinID: NP_001002857
OMIM: 151740
HGNC: 537
Ensembl: ENSG00000182718
Vega: OTTHUMG00000132763
Pharos: P07355(Tbio)
UniProt: P07355 A0A024R5Z7
Structure
PDB: 

Position
15q22.2
AA seq 339 aa AA seqDB search
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNIL
TNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDM
LESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgttcacgaaatcctgtgcaagctcagcttggagggtgatcactctacaccc
ccaagtgcatatgggtctgtcaaagcctatactaactttgatgctgagcgggatgctttg
aacattgaaacagccatcaagaccaaaggtgtggatgaggtcaccattgtcaacattttg
accaaccgcagcaatgcacagagacaggatattgccttcgcctaccagagaaggaccaaa
aaggaacttgcatcagcactgaagtcagccttatctggccacctggagacggtgattttg
ggcctattgaagacacctgctcagtatgacgcttctgagctaaaagcttccatgaagggg
ctgggaaccgacgaggactctctcattgagatcatctgctccagaaccaaccaggagctg
caggaaattaacagagtctacaaggaaatgtacaagactgatctggagaaggacattatt
tcggacacatctggtgacttccgcaagctgatggttgccctggcaaagggtagaagagca
gaggatggctctgtcattgattatgaactgattgaccaagatgctcgggatctctatgac
gctggagtgaagaggaaaggaactgatgttcccaagtggatcagcatcatgaccgagcgg
agcgtgccccacctccagaaagtatttgataggtacaagagttacagcccttatgacatg
ttggaaagcatcaggaaagaggttaaaggagacctggaaaatgctttcctgaacctggtt
cagtgcattcagaacaagcccctgtattttgctgatcggctgtatgactccatgaagggc
aaggggacgcgagataaggtcctgatcagaatcatggtctcccgcagtgaagtggacatg
ttgaaaattaggtctgaattcaagagaaagtacggcaagtccctgtactattatatccag
caagacactaagggcgactaccagaaagcgctgctgtacctgtgtggtggagatgactga

DBGET integrated database retrieval system