KEGG   Homo sapiens (human): 3020Help
Entry
3020              CDS       T01001                                 

Gene name
H3F3A, H3.3A, H3F3
Definition
(RefSeq) H3 histone family member 3A
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
N00125  IGH-MMSET fusion to transcriptional activation
Disease
H01470  Giant cell tumor of bone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    3020 (H3F3A)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    3020 (H3F3A)
  09165 Substance dependence
   05034 Alcoholism
    3020 (H3F3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3020 (H3F3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3020 (H3F3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    3020 (H3F3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3020 (H3F3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3020
NCBI-ProteinID: NP_002098
OMIM: 601128
HGNC: 4764
Ensembl: ENSG00000163041
Vega: OTTHUMG00000037507
UniProt: P84243 B2R4P9
Structure
PDB: 

Position
1q42.12
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtggcgctccgtgaaattagacgttatcagaagtccactgaa
cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa
acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system