KEGG   Homo sapiens (human): 3021
Entry
3021              CDS       T01001                                 

Gene name
H3-3B, H3-3A, H3.3B, H3F3B
Definition
(RefSeq) H3.3 histone B
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3021 (H3-3B)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3021 (H3-3B)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    3021 (H3-3B)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3021 (H3-3B)
  09165 Substance dependence
   05034 Alcoholism
    3021 (H3-3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3021 (H3-3B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3021 (H3-3B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3021 (H3-3B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3021 (H3-3B)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3021
NCBI-ProteinID: NP_005315
OMIM: 601058
HGNC: 4765
Ensembl: ENSG00000132475
Vega: OTTHUMG00000179842
Pharos: P84243(Tbio)
UniProt: P84243 B2R4P9
Structure
PDB: 

Position
17q25.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgctcgtaagtccaccggtgggaaagccccccgcaaacag
ctggccacgaaagccgccaggaaaagcgctccctctaccggcggggtgaagaagcctcat
cgctacaggcccgggaccgtggcgcttcgagagattcgtcgttatcagaagtcgaccgag
ctgctcatccggaagctgcccttccagaggttggtgagggagatcgcgcaggatttcaaa
accgacctgaggtttcagagcgcagccatcggtgcgctgcaggaggctagcgaagcgtac
ctggtgggtctgttcgaagataccaacctgtgtgccatccacgctaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system