KEGG   Homo sapiens (human): 3024
Entry
3024              CDS       T01001                                 

Gene name
H1-1, H1.1, H1A, H1F1, HIST1, HIST1H1A
Definition
(RefSeq) H1.1 linker histone, cluster member
  KO
K11275  histone H1/5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3024 (H1-1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3024 (H1-1)
SSDB
Motif
Pfam: Linker_histone
Other DBs
NCBI-GeneID: 3024
NCBI-ProteinID: NP_005316
OMIM: 142709
HGNC: 4715
Ensembl: ENSG00000124610
Vega: OTTHUMG00000016413
Pharos: Q02539(Tbio)
UniProt: Q02539
Position
6p22.2
AA seq 215 aa
MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGV
SLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETK
PGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKV
AKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtctgaaacagtgcctcccgcccccgccgcttctgctgctcctgagaaacctttagct
ggcaagaaggcaaagaaacctgctaaggctgcagcagcctccaagaaaaaacccgctggc
ccttccgtgtcagagctgatcgtgcaggctgcttcctcctctaaggagcgtggtggtgtg
tcgttggcagctcttaaaaaggcgctggcggccgcaggctacgacgtggagaagaacaac
agccgcattaagctgggcattaagagcctggtaagcaagggaacgttggtgcagacaaag
ggtaccggagcctcgggttccttcaagctcaacaagaaggcgtcctccgtggaaaccaag
cccggcgcctcaaaggtggctacaaaaactaaggcaacgggtgcatctaaaaagctcaaa
aaggccacgggggctagcaaaaagagcgtcaagactccgaaaaaggctaaaaagcctgcg
gcaacaaggaaatcctccaagaatccaaaaaaacccaaaactgtaaagcccaagaaagta
gctaaaagccctgctaaagctaaggctgtaaaacccaaggcggccaaggctagggtgacg
aagccaaagactgccaaacccaagaaagcggcacccaagaaaaagtaa

DBGET integrated database retrieval system