KEGG   Homo sapiens (human): 3028Help
Entry
3028              CDS       T01001                                 

Gene name
HSD17B10, 17b-HSD10, ABAD, CAMR, DUPXp11.22, ERAB, HADH2, HCD2, HSD10MD, MHBD, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 10
  KO
K08683  3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
hsa05010  Alzheimer disease
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00856  Isoleucine degradation
N00857  HSD17B10 deficiency in isoleucine degradation
Disease
H00925  2-Methyl-3-hydroxybutyryl-CoA dehydrogenase (MHBD) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3028 (HSD17B10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3028 (HSD17B10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3028 (HSD17B10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3028 (HSD17B10)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     3028 (HSD17B10)
    1.1.1.178  3-hydroxy-2-methylbutyryl-CoA dehydrogenase
     3028 (HSD17B10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    3028 (HSD17B10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   3028 (HSD17B10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-GeneID: 3028
NCBI-ProteinID: NP_004484
OMIM: 300256
HGNC: 4800
Ensembl: ENSG00000072506
Vega: OTTHUMG00000021612
Pharos: Q99714(Tbio)
UniProt: Q99714 A0A0S2Z410
Structure
PDB: 

Position
Xp11.22
AA seq 261 aa AA seqDB search
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF
APADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDV
NLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAI
IENPFLNGEVIRLDGAIRMQP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcgtgtcggagcgtgaagggcctggtggcggtaataaccggaggagcctcg
ggcctgggcctggccacggcggagcgacttgtggggcagggagcctctgctgtgcttctg
gacctgcccaactcgggtggggaggcccaagccaagaagttaggaaacaactgcgttttc
gccccagccgacgtgacctctgagaaggatgtgcaaacagctctggctctagcaaaagga
aagtttggccgtgtggatgtagctgtcaactgtgcaggcatcgcggtggctagcaagacg
tacaacttaaagaagggccagacccataccttggaagacttccagcgagttcttgatgtg
aatctcatgggcaccttcaatgtgatccgcctggtggctggtgagatgggccagaatgaa
ccagaccagggaggccaacgtggggtcatcatcaacactgccagtgtggctgccttcgag
ggtcaggttggacaagctgcatactctgcttccaaggggggaatagtgggcatgacactg
cccattgctcgggatctggctcccataggtatccgggtgatgaccattgccccaggtctg
tttggcaccccactgctgaccagcctcccagagaaagtgtgcaacttcttggccagccaa
gtgcccttccctagccgactgggtgaccctgctgagtatgctcacctcgtacaggccatc
atcgagaacccattcctcaatggagaggtcatccggctggatggggccattcgtatgcag
ccttga

DBGET integrated database retrieval system