KEGG   Homo sapiens (human): 3034
Entry
3034              CDS       T01001                                 

Gene name
HAL, HIS, HSTD
Definition
(RefSeq) histidine ammonia-lyase
  KO
K01745  histidine ammonia-lyase [EC:4.3.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00340  Histidine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Disease
H00171  Histidinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    3034 (HAL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     3034 (HAL)
SSDB
Motif
Pfam: Lyase_aromatic Par3_HAL_N_term NFACT-C
Other DBs
NCBI-GeneID: 3034
NCBI-ProteinID: NP_002099
OMIM: 609457
HGNC: 4806
Ensembl: ENSG00000084110
Vega: OTTHUMG00000170354
Pharos: P42357(Tbio)
UniProt: P42357
Position
12q23.1
AA seq 657 aa
MPRYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFTSVDDAHFLVRRCKG
LGLLDNEDRLEVALENNEFVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDR
LTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTVIPI
NKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNAS
CLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPK
EGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHALRPHRG
QIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITT
ELNSATDNPMVFANRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNPSLS
ELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAAR
KALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDI
EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgcccagatacacggtgcacgtacgtggggaatggctggcagtgccctgccaggacgcg
cagctcactgtgggctggctgggccgggaggccgtgaggcgctatatcaagaataagccc
gacaatggtggcttcacctccgtggatgacgcgcacttccttgtgcgccggtgcaagggc
ctgggcctgctggacaacgaggaccggctcgaggtggccctagagaacaacgagttcgtg
gaagtggttatagagggtgatgccatgtctcctgacttcattccatctcaaccagaagga
gtttatctatacagcaagtaccgggagcctgaaaagtacatcgagttagatggagaccgt
ctgaccacggaggatctggtcaacttgggaaagggacgctacaaaataaagctcacccca
acagctgagaagagggtgcagaaatccagggaggtcatagatagcatcataaaagagaaa
acagttgtttacggtattactacaggttttgggaaatttgccagaactgtaattcctatc
aataagctacaggagcttcaggtcaacttagtacgctcacattcttcaggtgttgggaaa
ccactaagtcctgagaggtgtcggatgctcttggctttaaggatcaatgtcttagccaaa
ggatacagtggcatttccctggagaccctcaaacaagtcatagaaatgtttaatgcctcc
tgcctgccctatgtcccagagaaaggaaccgttggtgccagtggagaccttgccccactc
tctcatcttgctcttgggctagttggagaagggaagatgtggtctccgaagagtggctgg
gctgatgctaaatacgtgctagaagcccatggattgaaaccagttattttaaaaccaaaa
gagggcctggcactcatcaatgggacgcagatgatcacatccctgggctgtgaagctgta
gagcgagccagtgctattgcacggcaggctgacattgtggcagccctgacccttgaggtg
ctgaagggcaccaccaaagcctttgacactgacattcatgctcttcgacctcaccgtggg
caaattgaagttgcttttcggtttcggtcactcttggactcagatcaccacccatcagaa
atagcagagagtcacaggttctgtgatcgcgtccaggatgcatacaccttgcgctgctgt
ccacaggtccatggtgtggtgaatgatacaatagcatttgtgaagaacatcattaccaca
gaactgaacagcgcaacagataatcctatggtctttgccaataggggagagacagtttct
ggaggaaacttccatggtgaatacccagccaaagccctagactacttggccattggcatc
catgaacttgctgcaatcagtgagagaagaatcgagcggctctgcaatccctccctcagt
gagctgcctgccttcctggtggctgaaggtggtctgaactctgggttcatgatagctcac
tgcacggcagcagcccttgtttctgagaacaaggctctgtgccatccctcgtctgttgac
tccctctccaccagcgcagccacggaggaccacgtctccatgggaggatgggcagcaagg
aaagccctcagggtcatcgagcatgtggagcaagtgctggccatcgagctccttgcagcc
tgccagggcatagagtttctacgtcccctgaaaacaaccactccgctggagaaggtctat
gacctggtgcgctctgttgtaaggccctggataaaagatcgcttcatggccccggacatc
gaggcagcccacaggctgctcctggagcagaaggtttgggaagtagctgctccatacatt
gaaaaatacagaatggagcatattccagaatcaagacctctttctccaacagccttttca
ctgcaatttctgcacaagaaatccaccaaaatcccggagtctgaggacctttaa

DBGET integrated database retrieval system