KEGG   Homo sapiens (human): 3049
Entry
3049              CDS       T01001                                 
Symbol
HBQ1, HBQ
Name
(RefSeq) hemoglobin subunit theta 1
  KO
K13827  hemoglobin subunit theta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    3049 (HBQ1)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 3049
NCBI-ProteinID: NP_005322
OMIM: 142240
HGNC: 4833
Ensembl: ENSG00000086506
Pharos: P09105(Tbio)
UniProt: P09105 A0A1K0GUV5
Position
16:180459..181179
AA seq 142 aa
MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHG
QKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSP
ALQASLDKFLSHVISALVSEYR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcgctgtccgcggaggaccgggcgctggtgcgcgccctgtggaagaagctgggcagc
aacgtcggcgtctacacgacagaggccctggaaaggaccttcctggctttccccgccacg
aagacctacttctcccacctggacctgagccccggctcctcacaagtcagagcccacggc
cagaaggtggcggacgcgctgagcctcgccgtggagcgcctggacgacctaccccacgcg
ctgtccgcgctgagccacctgcacgcgtgccagctgcgagtggacccggccagcttccag
ctcctgggccactgcctgctggtaaccctcgcccggcactaccccggagacttcagcccc
gcgctgcaggcgtcgctggacaagttcctgagccacgttatctcggcgctggtttccgag
taccgctga

DBGET integrated database retrieval system