KEGG   Homo sapiens (human): 3053
Entry
3053              CDS       T01001                                 

Symbol
SERPIND1, D22S673, HC2, HCF2, HCII, HLS2, LS2, THPH10
Name
(RefSeq) serpin family D member 1
  KO
K03912  heparin cofactor II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H00223  Inherited thrombophilia
Drug target
Heparin (DG00150): D02980
Sulodexide: D08547
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3053 (SERPIND1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3053 (SERPIND1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3053 (SERPIND1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3053 (SERPIND1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   3053 (SERPIND1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3053 (SERPIND1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   3053 (SERPIND1)
SSDB
Motif
Pfam: Serpin AAA_9
Other DBs
NCBI-GeneID: 3053
NCBI-ProteinID: NP_000176
OMIM: 142360
HGNC: 4838
Ensembl: ENSG00000099937
Vega: OTTHUMG00000150755
Pharos: P05546(Tbio)
UniProt: P05546 Q8IVC0
Structure
PDB: 

Position
22q11.21
AA seq 499 aa
MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFH
KENTVTNDWIPEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGK
SRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSI
LHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKV
REYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWV
NKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVP
HKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDK
NGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIY
EHRTSCLLFMGRVANPSRS
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaaacactcattaaacgcacttctcattttcctcatcataacatctgcgtggggtggg
agcaaaggcccgctggatcagctagagaaaggaggggaaactgctcagtctgcagatccc
cagtgggagcagttaaataacaaaaacctgagcatgcctcttctccctgccgacttccac
aaggaaaacaccgtcaccaacgactggattccagagggggaggaggacgacgactatctg
gacctggagaagatattcagtgaagacgacgactacatcgacatcgtcgacagtctgtca
gtttccccgacagactctgatgtgagtgctgggaacatcctccagctttttcatggcaag
agccggatccagcgtcttaacatcctcaacgccaagttcgctttcaacctctaccgagtg
ctgaaagaccaggtcaacactttcgataacatcttcatagcacccgttggcatttctact
gcgatgggtatgatttccttaggtctgaagggagagacccatgaacaagtgcactcgatt
ttgcattttaaagactttgttaatgccagcagcaagtatgaaatcacgaccattcataat
ctcttccgtaagctgactcatcgcctcttcaggaggaattttgggtacacactgcggtca
gtcaatgacctttatatccagaagcagtttccaatcctgcttgacttcaaaactaaagta
agagagtattactttgctgaggcccagatagctgacttctcagaccctgccttcatatca
aaaaccaacaaccacatcatgaagctcaccaagggcctcataaaagatgctctggagaat
atagaccctgctacccagatgatgattctcaactgcatctacttcaaaggatcctgggtg
aataaattcccagtggaaatgacacacaaccacaacttccggctgaatgagagagaggta
gttaaggtttccatgatgcagaccaaggggaacttcctcgcagcaaatgaccaggagctg
gactgcgacatcctccagctggaatacgtggggggcatcagcatgctaattgtggtccca
cacaagatgtctgggatgaagaccctcgaagcgcaactgacaccccgggtggtggagaga
tggcaaaaaagcatgacaaacagaactcgagaagtgcttctgccgaaattcaagctggag
aagaactacaatctagtggagtccctgaagttgatggggatcaggatgctgtttgacaaa
aatggcaacatggcaggcatctcagaccaaaggatcgccatcgacctgttcaagcaccaa
ggcacgatcacagtgaacgaggaaggcacccaagccaccactgtgaccacggtggggttc
atgccgctgtccacccaagtccgcttcactgtcgaccgcccctttcttttcctcatctac
gagcatcgcaccagctgcctgctcttcatgggaagagtggccaaccccagcaggtcctag

DBGET integrated database retrieval system