KEGG   Homo sapiens (human): 3059Help
Entry
3059              CDS       T01001                                 

Gene name
HCLS1, CTTNL, HS1, lckBP1, p75
Definition
(RefSeq) hematopoietic cell-specific Lyn substrate 1
  KO
K06106  cortactin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    3059 (HCLS1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    3059 (HCLS1)
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    3059 (HCLS1)
   05131 Shigellosis
    3059 (HCLS1)
   05100 Bacterial invasion of epithelial cells
    3059 (HCLS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3059 (HCLS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3059 (HCLS1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    3059 (HCLS1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    3059 (HCLS1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     3059 (HCLS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HS1_rep SH3_1 SH3_9 SH3_2 SPESP1 DUF4100
Motif
Other DBs
NCBI-GeneID: 3059
NCBI-ProteinID: NP_005326
OMIM: 601306
HGNC: 4844
Ensembl: ENSG00000180353
Vega: OTTHUMG00000159409
Pharos: P14317(Tbio)
UniProt: P14317
Position
3q13.33
AA seq 486 aa AA seqDB search
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGF
GGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKA
KFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISS
EAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVY
EAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPA
GAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPAN
YVKLLE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagtctgtagtgggccatgatgtgtctgtttccgtggagacccagggtgatgat
tgggacacagatcctgactttgtgaatgacatctctgaaaaggagcaacgatggggagcc
aagaccatcgaggggtctggacgcacagaacacatcaacatccaccagctgaggaacaaa
gtatcagaggagcatgatgttctcaggaagaaagagatggagtcagggcccaaagcatcc
catggctatggaggtcggtttggagtagaaagagaccgaatggacaagagtgcagtgggc
catgagtatgttgccgaggtggagaagcactcttctcagacggatgctgccaaaggcttt
gggggcaagtacggagttgagagggacagggcagacaagtcagcagtcggctttgattat
aaaggagaagtggagaagcacacatctcagaaagattactctcgtggctttggtggccgg
tacggggtggagaaggataaatgggacaaagcagctctgggatatgactacaagggagag
acggagaaacacgagtcccagagagattatgccaagggctttggtggccagtatggaatc
cagaaggaccgagtggataagagcgctgtcggcttcaatgaaatggaggccccgaccaca
gcttataagaagacgacgcccatagaagccgcttctagtggtacccgtgggctgaaggcg
aaatttgagtccatggctgaggagaagaggaagcgagaggaagaggagaaggcacagcag
gtggccaggaggcaacaggagcgaaaggctgtgacaaagaggagccctgaggctccacag
ccagtgatagctatggaagagccagcagtaccggccccactgcccaagaaaatctcctca
gaggcctggcctccagttgggactcctccatcatcagagtctgagcctgtgagaaccagc
agggaacacccagtgcccttgctgcccattaggcagactctcccggaggacaatgaggag
cccccagctctgccccctaggactctggaaggcctccaggtggaggaagagccagtgtac
gaagcagagcctgagcctgagcccgagcctgagcccgagcctgagaatgactatgaggac
gttgaggagatggacaggcatgagcaggaggatgaaccagagggggactatgaggaggtg
ctcgagcctgaagattcttctttttcttctgctctggctggatcatcaggctgcccggct
ggggctggggctggggctgtggctctggggatctcagctgtggctctatatgattaccaa
ggagagggaagtgatgagctttcctttgatccggacgacgtaatcactgacattgagatg
gtggacgagggctggtggcggggacgttgccatggccactttggactcttccctgcaaat
tatgtcaagcttctggagtga

DBGET integrated database retrieval system