KEGG   Homo sapiens (human): 306
Entry
306               CDS       T01001                                 

Gene name
ANXA3, ANX3
Definition
(RefSeq) annexin A3
  KO
K17089  annexin A3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    306 (ANXA3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   306 (ANXA3)
SSDB
Motif
Pfam: Annexin RPT VPS13_C
Other DBs
NCBI-GeneID: 306
NCBI-ProteinID: NP_005130
OMIM: 106490
HGNC: 541
Ensembl: ENSG00000138772
Vega: OTTHUMG00000130198
Pharos: P12429(Tbio)
UniProt: P12429
Structure
PDB: 
1AXN 1AII

Position
4q21.21
AA seq 323 aa
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEY
QAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR
TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQ
ILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL
LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY
SAIKSDTSGDYEITLLKICGGDD
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcatctatctgggttggacaccgaggaacagtaagagattatccagactttagccca
tcagtggatgctgaagctattcagaaagcaatcagaggaattggaactgatgagaaaatg
ctcatcagcattctgactgagaggtcaaatgcacagcggcagctgattgttaaggaatat
caagcagcatatggaaaggagctgaaagatgacttgaagggtgatctctctggccacttt
gagcatctcatggtggccctagtgactccaccagcagtctttgatgcaaagcagctaaag
aaatccatgaagggcgcgggaacaaacgaagatgccttgattgaaatcttaactaccagg
acaagcaggcaaatgaaggatatctctcaagcctattatacagtatacaagaagagtctt
ggagatgacattagttccgaaacatctggtgacttccggaaagctctgttgactttggca
gatggcagaagagatgaaagtctgaaagtggatgagcatctggccaaacaagatgcccag
attctctataaagctggtgagaacagatggggcacggatgaagacaaattcactgagatc
ctgtgtttaaggagctttcctcaattaaaactaacatttgatgaatacagaaatatcagc
caaaaggacattgtggacagcataaaaggagaattatctgggcattttgaagacttactg
ttggccatagttaattgtgtgaggaacacgccggcctttttagccgaaagactgcatcga
gccttgaagggtattggaactgatgagtttactctgaaccgaataatggtgtccagatca
gaaattgaccttttggacattcgaacagagttcaagaagcattatggctattccctatat
tcagcaattaaatcggatacttctggagactatgaaatcacactcttaaaaatctgtggt
ggagatgactga

DBGET integrated database retrieval system