KEGG   Homo sapiens (human): 3061Help
Entry
3061              CDS       T01001                                 

Gene name
HCRTR1, OX1R
Definition
(RefSeq) hypocretin receptor 1
  KO
K04238  hypocretin (orexin) receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Almorexant: D09964
Filorexant: D10345
Suvorexant: D10082
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3061 (HCRTR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Orexin
    3061 (HCRTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_4 Orexin_rec2
Motif
Other DBs
NCBI-GeneID: 3061
NCBI-ProteinID: NP_001516
OMIM: 602392
HGNC: 4848
Ensembl: ENSG00000121764
Vega: OTTHUMG00000003876
Pharos: O43613(Tclin)
UniProt: O43613
Position
1p35.2
AA seq 425 aa AA seqDB search
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggagccctcagccaccccaggggcccagatgggggtcccccctggcagcagagagccg
tcccctgtgcctccagactatgaagatgagtttctccgctatctgtggcgcgattatctg
tacccaaaacagtatgagtgggtcctcatcgcagcctatgtggctgtgttcgtcgtggcc
ctggtgggcaacacgctggtctgcctggccgtgtggcggaaccaccacatgaggacagtc
accaactacttcattgtcaacctgtccctggctgacgttctggtgactgctatctgcctg
ccggccagcctgctggtggacatcactgagtcctggctgttcggccatgccctctgcaag
gtcatcccctatctacaggctgtgtccgtgtcagtggcagtgctaactctcagcttcatc
gccctggaccgctggtatgccatctgccacccactattgttcaagagcacagcccggcgg
gcccgtggctccatcctgggcatctgggctgtgtcgctggccatcatggtgccccaggct
gcagtcatggaatgcagcagtgtgctgcctgagctagccaaccgcacacggctcttctca
gtctgtgatgaacgctgggcagatgacctctatcccaagatctaccacagttgcttcttt
attgtcacctacctggccccactgggcctcatggccatggcctatttccagatattccgc
aagctctggggccgccagatccccggcaccacctcagcactggtgcggaactggaagcgc
ccctcagaccagctgggggacctggagcagggcctgagtggagagccccagccccgggcc
cgcgccttcctggctgaagtgaagcagatgcgtgcacggaggaagacagccaagatgctg
atggtggtgctgctggtcttcgccctctgctacctgcccatcagcgtcctcaatgtcctt
aagagggtgttcgggatgttccgccaagccagtgaccgcgaagctgtctacgcctgcttc
accttctcccactggctggtgtacgccaacagcgctgccaaccccatcatctacaacttc
ctcagtggcaaattccgggagcagtttaaggctgccttctcctgctgcctgcctggcctg
ggtccctgcggctctctgaaggcccctagtccccgctcctctgccagccacaagtccttg
tccttgcagagccgatgctccatctccaaaatctctgagcatgtggtgctcaccagcgtc
accacagtgctgccctga

DBGET integrated database retrieval system