KEGG   Homo sapiens (human): 3062Help
Entry
3062              CDS       T01001                                 

Gene name
HCRTR2, OX2R
Definition
(RefSeq) hypocretin receptor 2
  KO
K04239  hypocretin (orexin) receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Almorexant: D09964
Filorexant: D10345
Suvorexant: D10082
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3062 (HCRTR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Orexin
    3062 (HCRTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Orexin_rec2 7TM_GPCR_Srsx 7tm_4 SNARE
Motif
Other DBs
NCBI-GeneID: 3062
NCBI-ProteinID: NP_001517
OMIM: 602393
HGNC: 4849
Ensembl: ENSG00000137252
Vega: OTTHUMG00000016150
Pharos: O43614(Tclin)
UniProt: O43614 S4X0W3
Position
6p12.1
AA seq 444 aa AA seqDB search
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaccaaattggaggactcccccccttgtcgcaactggtcatctgcttcggag
ctgaatgaaactcaagagccctttttaaaccccaccgactatgacgacgaggaattcctg
cggtacctgtggagggaatacctgcacccgaaagaatatgagtgggtcctgatcgccggg
tacatcatcgtgttcgtcgtggctctcattgggaacgtcctggtttgtgtggcagtgtgg
aagaaccaccacatgaggacggtaaccaactacttcatagtcaatctttctctggctgat
gtgctcgtgaccatcacctgccttccagccacactggtcgtggatatcactgagacctgg
ttttttggacagtccctttgcaaagtgattccttatctacagaccgtgtcggtgtctgtg
tctgtcctcacactgagctgtatcgccttggatcggtggtatgcaatctgtcaccctttg
atgtttaagagcacagcaaagcgggcccgtaacagcattgtcatcatctggattgtctcc
tgcattataatgattcctcaggccatcgtcatggagtgcagcaccgtgttcccaggctta
gccaataaaaccaccctctttacggtgtgtgatgagcgctggggtggtgaaatttatccc
aagatgtaccacatctgtttctttctggtgacatacatggcaccactgtgtctcatggtg
ttggcttatctgcaaatatttcgcaaactctggtgtcgacagatccctggaacatcatct
gtagttcagagaaaatggaagcccctgcagcctgtttcacagcctcgagggccaggacag
ccaacgaagtcccggatgagcgctgtggcggctgaaataaagcagatccgagccagaagg
aaaacagcccggatgttgatgattgtgcttttggtatttgcaatttgctatctaccaatt
agcatcctcaatgtgctaaagagagtatttgggatgtttgcccatactgaagacagagag
actgtgtatgcctggtttaccttttcacactggcttgtatatgccaatagtgctgcgaat
ccaattatttataattttctcagtggaaaatttcgagaggaatttaaagctgcgttttct
tgctgttgccttggagttcaccatcgccaggaggatcggctcaccaggggacgaactagc
acagagagccggaagtccttgaccactcaaatcagcaactttgataacatatcaaaactt
tctgagcaagttgtgctcactagcataagcacactcccagcagccaatggagcaggacca
cttcaaaactggtag

DBGET integrated database retrieval system