KEGG   Homo sapiens (human): 307
Entry
307               CDS       T01001                                 
Symbol
ANXA4, ANX4, HEL-S-274, P32.5, PAP-II, PIG28, PP4-X, ZAP36
Name
(RefSeq) annexin A4
  KO
K17093  annexin A4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    307 (ANXA4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    307 (ANXA4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    307 (ANXA4)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    307 (ANXA4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   307 (ANXA4)
  Exosomal proteins of other body fluids (saliva and urine)
   307 (ANXA4)
  Exosomal proteins of colorectal cancer cells
   307 (ANXA4)
  Exosomal proteins of bladder cancer cells
   307 (ANXA4)
SSDB
Motif
Pfam: Annexin TSLP
Other DBs
NCBI-GeneID: 307
NCBI-ProteinID: NP_001144
OMIM: 106491
HGNC: 542
Ensembl: ENSG00000196975
Pharos: P09525(Tbio)
UniProt: P09525 Q6P452
Structure
Position
2:69643808..69827112
AA seq 321 aa
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKS
TIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTP
EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDL
YEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
IVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSF
IKGDTSGDYRKVLLVLCGGDD
NT seq 966 nt   +upstreamnt  +downstreamnt
atggccatggcaaccaaaggaggtactgtcaaagctgcttcaggattcaatgccatggaa
gatgcccagaccctgaggaaggccatgaaagggctcggcaccgatgaagacgccattatt
agcgtccttgcctaccgcaacaccgcccagcgccaggagatcaggacagcctacaagagc
accatcggcagggacttgatagacgacctgaagtcagaactgagtggcaacttcgagcag
gtgattgtggggatgatgacgcccacggtgctgtatgacgtgcaagagctgcgaagggcc
atgaagggagccggcactgatgagggctgcctaattgagatcctggcctcccggacccct
gaggagatccggcgcataagccaaacctaccagcagcaatatggacggagccttgaagat
gacattcgctctgacacatcgttcatgttccagcgagtgctggtgtctctgtcagctggt
gggagggatgaaggaaattatctggacgatgctctcgtgagacaggatgcccaggacctg
tatgaggctggagagaagaaatgggggacagatgaggtgaaatttctaactgttctctgt
tcccggaaccgaaatcacctgttgcatgtgtttgatgaatacaaaaggatatcacagaag
gatattgaacagagtattaaatctgaaacatctggtagctttgaagatgctctgctggct
atagtaaagtgcatgaggaacaaatctgcatattttgctgaaaagctctataaatcgatg
aagggcttgggcaccgatgataacaccctcatcagagtgatggtttctcgagcagaaatt
gacatgttggatatccgggcacacttcaagagactctatggaaagtctctgtactcgttc
atcaagggtgacacatctggagactacaggaaagtactgcttgttctctgtggaggagat
gattaa

DBGET integrated database retrieval system