KEGG   Homo sapiens (human): 3075Help
Entry
3075              CDS       T01001                                 

Gene name
CFH, AHUS1, AMBP1, ARMD4, ARMS1, CFHL3, FH, FHL1, HF, HF1, HF2, HUS
Definition
(RefSeq) complement factor H
  KO
K04004  complement factor H
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
Disease
H00104  Alternative complement pathway component defects
H00821  Age-related macular degeneration
H00825  Familial flecked retina syndrome
H01434  Atypical hemolytic uremic syndrome
H01726  Membranoproliferative glomerulonephritis
H02108  Basal laminar drusen
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3075 (CFH)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    3075 (CFH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3075 (CFH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3075 (CFH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Sushi_2
Motif
Other DBs
NCBI-GeneID: 3075
NCBI-ProteinID: NP_000177
OMIM: 134370
HGNC: 4883
Ensembl: ENSG00000000971
Vega: OTTHUMG00000035607
Pharos: P08603(Tbio)
UniProt: P08603 A0A024R962
Structure
PDB: 

Position
1q31.3
AA seq 1231 aa AA seqDB search
MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG
NVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQL
LGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNS
GYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMG
YEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYP
ATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEH
FETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGY
ALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLG
YVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGY
ESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPG
FTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCN
PRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCS
ESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYR
CRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQ
ENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYT
CEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCF
EGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCAT
YYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSP
YEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQN
LYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFV
CKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atgagacttctagcaaagattatttgccttatgttatgggctatttgtgtagcagaagat
tgcaatgaacttcctccaagaagaaatacagaaattctgacaggttcctggtctgaccaa
acatatccagaaggcacccaggctatctataaatgccgccctggatatagatctcttgga
aatgtaataatggtatgcaggaagggagaatgggttgctcttaatccattaaggaaatgt
cagaaaaggccctgtggacatcctggagatactccttttggtacttttacccttacagga
ggaaatgtgtttgaatatggtgtaaaagctgtgtatacatgtaatgaggggtatcaattg
ctaggtgagattaattaccgtgaatgtgacacagatggatggaccaatgatattcctata
tgtgaagttgtgaagtgtttaccagtgacagcaccagagaatggaaaaattgtcagtagt
gcaatggaaccagatcgggaataccattttggacaagcagtacggtttgtatgtaactca
ggctacaagattgaaggagatgaagaaatgcattgttcagacgatggtttttggagtaaa
gagaaaccaaagtgtgtggaaatttcatgcaaatccccagatgttataaatggatctcct
atatctcagaagattatttataaggagaatgaacgatttcaatataaatgtaacatgggt
tatgaatacagtgaaagaggagatgctgtatgcactgaatctggatggcgtccgttgcct
tcatgtgaagaaaaatcatgtgataatccttatattccaaatggtgactactcaccttta
aggattaaacacagaactggagatgaaatcacgtaccagtgtagaaatggtttttatcct
gcaacccggggaaatacagcaaaatgcacaagtactggctggatacctgctccgagatgt
accttgaaaccttgtgattatccagacattaaacatggaggtctatatcatgagaatatg
cgtagaccatactttccagtagctgtaggaaaatattactcctattactgtgatgaacat
tttgagactccgtcaggaagttactgggatcacattcattgcacacaagatggatggtcg
ccagcagtaccatgcctcagaaaatgttattttccttatttggaaaatggatataatcaa
aatcatggaagaaagtttgtacagggtaaatctatagacgttgcctgccatcctggctac
gctcttccaaaagcgcagaccacagttacatgtatggagaatggctggtctcctactccc
agatgcatccgtgtcaaaacatgttccaaatcaagtatagatattgagaatgggtttatt
tctgaatctcagtatacatatgccttaaaagaaaaagcgaaatatcaatgcaaactagga
tatgtaacagcagatggtgaaacatcaggatcaattacatgtgggaaagatggatggtca
gctcaacccacgtgcattaaatcttgtgatatcccagtatttatgaatgccagaactaaa
aatgacttcacatggtttaagctgaatgacacattggactatgaatgccatgatggttat
gaaagcaatactggaagcaccactggttccatagtgtgtggttacaatggttggtctgat
ttacccatatgttatgaaagagaatgcgaacttcctaaaatagatgtacacttagttcct
gatcgcaagaaagaccagtataaagttggagaggtgttgaaattctcctgcaaaccagga
tttacaatagttggacctaattccgttcagtgctaccactttggattgtctcctgacctc
ccaatatgtaaagagcaagtacaatcatgtggtccacctcctgaactcctcaatgggaat
gttaaggaaaaaacgaaagaagaatatggacacagtgaagtggtggaatattattgcaat
cctagatttctaatgaagggacctaataaaattcaatgtgttgatggagagtggacaact
ttaccagtgtgtattgtggaggagagtacctgtggagatatacctgaacttgaacatggc
tgggcccagctttcttcccctccttattactatggagattcagtggaattcaattgctca
gaatcatttacaatgattggacacagatcaattacgtgtattcatggagtatggacccaa
cttccccagtgtgtggcaatagataaacttaagaagtgcaaatcatcaaatttaattata
cttgaggaacatttaaaaaacaagaaggaattcgatcataattctaacataaggtacaga
tgtagaggaaaagaaggatggatacacacagtctgcataaatggaagatgggatccagaa
gtgaactgctcaatggcacaaatacaattatgcccacctccacctcagattcccaattct
cacaatatgacaaccacactgaattatcgggatggagaaaaagtatctgttctttgccaa
gaaaattatctaattcaggaaggagaagaaattacatgcaaagatggaagatggcagtca
ataccactctgtgttgaaaaaattccatgttcacaaccacctcagatagaacacggaacc
attaattcatccaggtcttcacaagaaagttatgcacatgggactaaattgagttatact
tgtgagggtggtttcaggatatctgaagaaaatgaaacaacatgctacatgggaaaatgg
agttctccacctcagtgtgaaggccttccttgtaaatctccacctgagatttctcatggt
gttgtagctcacatgtcagacagttatcagtatggagaagaagttacgtacaaatgtttt
gaaggttttggaattgatgggcctgcaattgcaaaatgcttaggagaaaaatggtctcac
cctccatcatgcataaaaacagattgtctcagtttacctagctttgaaaatgccataccc
atgggagagaagaaggatgtgtataaggcgggtgagcaagtgacttacacttgtgcaaca
tattacaaaatggatggagccagtaatgtaacatgcattaatagcagatggacaggaagg
ccaacatgcagagacacctcctgtgtgaatccgcccacagtacaaaatgcttatatagtg
tcgagacagatgagtaaatatccatctggtgagagagtacgttatcaatgtaggagccct
tatgaaatgtttggggatgaagaagtgatgtgtttaaatggaaactggacggaaccacct
caatgcaaagattctacaggaaaatgtgggccccctccacctattgacaatggggacatt
acttcattcccgttgtcagtatatgctccagcttcatcagttgagtaccaatgccagaac
ttgtatcaacttgagggtaacaagcgaataacatgtagaaatggacaatggtcagaacca
ccaaaatgcttacatccgtgtgtaatatcccgagaaattatggaaaattataacatagca
ttaaggtggacagccaaacagaagctttattcgagaacaggtgaatcagttgaatttgtg
tgtaaacggggatatcgtctttcatcacgttctcacacattgcgaacaacatgttgggat
gggaaactggagtatccaacttgtgcaaaaagatag

DBGET integrated database retrieval system