KEGG   Homo sapiens (human): 3075Help
Entry
3075              CDS       T01001                                 

Gene name
CFH, AHUS1, AMBP1, ARMD4, ARMS1, CFHL3, FH, FHL1, HF, HF1, HF2, HUS
Definition
(RefSeq) complement factor H
  KO
K04004  complement factor H
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
Disease
H00104  Alternative complement pathway component defects
H00821  Age-related macular degeneration
H00825  Familial flecked retina syndrome
H01434  Atypical hemolytic uremic syndrome (aHUS)
H01726  Membranoproliferative glomerulonephritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3075 (CFH)
 09160 Human Diseases
  09167 Infectious diseases
   05150 Staphylococcus aureus infection
    3075 (CFH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3075 (CFH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3075 (CFH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Sushi_2
Motif
Other DBs
NCBI-GeneID: 3075
NCBI-ProteinID: NP_000177
OMIM: 134370
HGNC: 4883
Ensembl: ENSG00000000971
Vega: OTTHUMG00000035607
Pharos: P08603(Tbio)
UniProt: P08603 A0A024R962
Structure
PDB: 

Position
1q31.3
AA seq 1231 aa AA seqDB search
MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG
NVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQL
LGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNS
GYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMG
YEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYP
ATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEH
FETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGY
ALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLG
YVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGY
ESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPG
FTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCN
PRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCS
ESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYR
CRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQ
ENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYT
CEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCF
EGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCAT
YYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSP
YEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQN
LYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFV
CKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atgagacttctagcaaagattatttgccttatgttatgggctatttgtgtagcagaagat
tgcaatgaacttcctccaagaagaaatacagaaattctgacaggttcctggtctgaccaa
acatatccagaaggcacccaggctatctataaatgccgccctggatatagatctcttgga
aatgtaataatggtatgcaggaagggagaatgggttgctcttaatccattaaggaaatgt
cagaaaaggccctgtggacatcctggagatactccttttggtacttttacccttacagga
ggaaatgtgtttgaatatggtgtaaaagctgtgtatacatgtaatgaggggtatcaattg
ctaggtgagattaattaccgtgaatgtgacacagatggatggaccaatgatattcctata
tgtgaagttgtgaagtgtttaccagtgacagcaccagagaatggaaaaattgtcagtagt
gcaatggaaccagatcgggaataccattttggacaagcagtacggtttgtatgtaactca
ggctacaagattgaaggagatgaagaaatgcattgttcagacgatggtttttggagtaaa
gagaaaccaaagtgtgtggaaatttcatgcaaatccccagatgttataaatggatctcct
atatctcagaagattatttataaggagaatgaacgatttcaatataaatgtaacatgggt
tatgaatacagtgaaagaggagatgctgtatgcactgaatctggatggcgtccgttgcct
tcatgtgaagaaaaatcatgtgataatccttatattccaaatggtgactactcaccttta
aggattaaacacagaactggagatgaaatcacgtaccagtgtagaaatggtttttatcct
gcaacccggggaaatacagcaaaatgcacaagtactggctggatacctgctccgagatgt
accttgaaaccttgtgattatccagacattaaacatggaggtctatatcatgagaatatg
cgtagaccatactttccagtagctgtaggaaaatattactcctattactgtgatgaacat
tttgagactccgtcaggaagttactgggatcacattcattgcacacaagatggatggtcg
ccagcagtaccatgcctcagaaaatgttattttccttatttggaaaatggatataatcaa
aatcatggaagaaagtttgtacagggtaaatctatagacgttgcctgccatcctggctac
gctcttccaaaagcgcagaccacagttacatgtatggagaatggctggtctcctactccc
agatgcatccgtgtcaaaacatgttccaaatcaagtatagatattgagaatgggtttatt
tctgaatctcagtatacatatgccttaaaagaaaaagcgaaatatcaatgcaaactagga
tatgtaacagcagatggtgaaacatcaggatcaattacatgtgggaaagatggatggtca
gctcaacccacgtgcattaaatcttgtgatatcccagtatttatgaatgccagaactaaa
aatgacttcacatggtttaagctgaatgacacattggactatgaatgccatgatggttat
gaaagcaatactggaagcaccactggttccatagtgtgtggttacaatggttggtctgat
ttacccatatgttatgaaagagaatgcgaacttcctaaaatagatgtacacttagttcct
gatcgcaagaaagaccagtataaagttggagaggtgttgaaattctcctgcaaaccagga
tttacaatagttggacctaattccgttcagtgctaccactttggattgtctcctgacctc
ccaatatgtaaagagcaagtacaatcatgtggtccacctcctgaactcctcaatgggaat
gttaaggaaaaaacgaaagaagaatatggacacagtgaagtggtggaatattattgcaat
cctagatttctaatgaagggacctaataaaattcaatgtgttgatggagagtggacaact
ttaccagtgtgtattgtggaggagagtacctgtggagatatacctgaacttgaacatggc
tgggcccagctttcttcccctccttattactatggagattcagtggaattcaattgctca
gaatcatttacaatgattggacacagatcaattacgtgtattcatggagtatggacccaa
cttccccagtgtgtggcaatagataaacttaagaagtgcaaatcatcaaatttaattata
cttgaggaacatttaaaaaacaagaaggaattcgatcataattctaacataaggtacaga
tgtagaggaaaagaaggatggatacacacagtctgcataaatggaagatgggatccagaa
gtgaactgctcaatggcacaaatacaattatgcccacctccacctcagattcccaattct
cacaatatgacaaccacactgaattatcgggatggagaaaaagtatctgttctttgccaa
gaaaattatctaattcaggaaggagaagaaattacatgcaaagatggaagatggcagtca
ataccactctgtgttgaaaaaattccatgttcacaaccacctcagatagaacacggaacc
attaattcatccaggtcttcacaagaaagttatgcacatgggactaaattgagttatact
tgtgagggtggtttcaggatatctgaagaaaatgaaacaacatgctacatgggaaaatgg
agttctccacctcagtgtgaaggccttccttgtaaatctccacctgagatttctcatggt
gttgtagctcacatgtcagacagttatcagtatggagaagaagttacgtacaaatgtttt
gaaggttttggaattgatgggcctgcaattgcaaaatgcttaggagaaaaatggtctcac
cctccatcatgcataaaaacagattgtctcagtttacctagctttgaaaatgccataccc
atgggagagaagaaggatgtgtataaggcgggtgagcaagtgacttacacttgtgcaaca
tattacaaaatggatggagccagtaatgtaacatgcattaatagcagatggacaggaagg
ccaacatgcagagacacctcctgtgtgaatccgcccacagtacaaaatgcttatatagtg
tcgagacagatgagtaaatatccatctggtgagagagtacgttatcaatgtaggagccct
tatgaaatgtttggggatgaagaagtgatgtgtttaaatggaaactggacggaaccacct
caatgcaaagattctacaggaaaatgtgggccccctccacctattgacaatggggacatt
acttcattcccgttgtcagtatatgctccagcttcatcagttgagtaccaatgccagaac
ttgtatcaacttgagggtaacaagcgaataacatgtagaaatggacaatggtcagaacca
ccaaaatgcttacatccgtgtgtaatatcccgagaaattatggaaaattataacatagca
ttaaggtggacagccaaacagaagctttattcgagaacaggtgaatcagttgaatttgtg
tgtaaacggggatatcgtctttcatcacgttctcacacattgcgaacaacatgttgggat
gggaaactggagtatccaacttgtgcaaaaagatag

DBGET integrated database retrieval system