KEGG   Homo sapiens (human): 3077
Entry
3077              CDS       T01001                                 

Gene name
HFE, HFE1, HH, HLA-H, MVCD7, TFQTL2
Definition
(RefSeq) homeostatic iron regulator
Organism
hsa  Homo sapiens (human)
Disease
H00211  Hemochromatosis
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 Ig_2 Insulin_TMD Orf78 ig SKG6
Other DBs
NCBI-GeneID: 3077
NCBI-ProteinID: NP_000401
OMIM: 613609
HGNC: 4886
Ensembl: ENSG00000010704
Vega: OTTHUMG00000016348
Pharos: Q30201(Tbio)
UniProt: Q30201
Structure
PDB: 
1A6Z 1DE4

Position
6p22.2
AA seq 348 aa
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgggcccgcgagccaggccggcgcttctcctcctgatgcttttgcagaccgcggtcctg
caggggcgcttgctgcgttcacactctctgcactacctcttcatgggtgcctcagagcag
gaccttggtctttccttgtttgaagctttgggctacgtggatgaccagctgttcgtgttc
tatgatcatgagagtcgccgtgtggagccccgaactccatgggtttccagtagaatttca
agccagatgtggctgcagctgagtcagagtctgaaagggtgggatcacatgttcactgtt
gacttctggactattatggaaaatcacaaccacagcaaggagtcccacaccctgcaggtc
atcctgggctgtgaaatgcaagaagacaacagtaccgagggctactggaagtacgggtat
gatgggcaggaccaccttgaattctgccctgacacactggattggagagcagcagaaccc
agggcctggcccaccaagctggagtgggaaaggcacaagattcgggccaggcagaacagg
gcctacctggagagggactgccctgcacagctgcagcagttgctggagctggggagaggt
gttttggaccaacaagtgcctcctttggtgaaggtgacacatcatgtgacctcttcagtg
accactctacggtgtcgggccttgaactactacccccagaacatcaccatgaagtggctg
aaggataagcagccaatggatgccaaggagttcgaacctaaagacgtattgcccaatggg
gatgggacctaccagggctggataaccttggctgtaccccctggggaagagcagagatat
acgtgccaggtggagcacccaggcctggatcagcccctcattgtgatctgggagccctca
ccgtctggcaccctagtcattggagtcatcagtggaattgctgtttttgtcgtcatcttg
ttcattggaattttgttcataatattaaggaagaggcagggttcaagaggagccatgggg
cactacgtcttagctgaacgtgagtga

DBGET integrated database retrieval system