KEGG   Homo sapiens (human): 308
Entry
308               CDS       T01001                                 

Gene name
ANXA5, ANX5, ENX2, HEL-S-7, PP4, RPRGL3
Definition
(RefSeq) annexin A5
  KO
K16646  annexin A5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    308 (ANXA5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    308 (ANXA5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   308 (ANXA5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Others
   308 (ANXA5)
SSDB
Motif
Pfam: Annexin
Other DBs
NCBI-GeneID: 308
NCBI-ProteinID: NP_001145
OMIM: 131230
HGNC: 543
Ensembl: ENSG00000164111
Vega: OTTHUMG00000133034
Pharos: P08758(Tbio)
UniProt: P08758 V9HWE0
Structure
PDB: 

Position
4q27
AA seq 320 aa
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTL
FGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
ELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALF
QAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAV
VKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI
KGDTSGDYKKALLLLCGEDD
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcacaggttctcagaggcactgtgactgacttccctggatttgatgagcgggctgat
gcagaaactcttcggaaggctatgaaaggcttgggcacagatgaggagagcatcctgact
ctgttgacatcccgaagtaatgctcagcgccaggaaatctctgcagcttttaagactctg
tttggcagggatcttctggatgacctgaaatcagaactaactggaaaatttgaaaaatta
attgtggctctgatgaaaccctctcggctttatgatgcttatgaactgaaacatgccttg
aagggagctggaacaaatgaaaaagtactgacagaaattattgcttcaaggacacctgaa
gaactgagagccatcaaacaagtttatgaagaagaatatggctcaagcctggaagatgac
gtggtgggggacacttcagggtactaccagcggatgttggtggttctccttcaggctaac
agagaccctgatgctggaattgatgaagctcaagttgaacaagatgctcaggctttattt
caggctggagaacttaaatgggggacagatgaagaaaagtttatcaccatctttggaaca
cgaagtgtgtctcatttgagaaaggtgtttgacaagtacatgactatatcaggatttcaa
attgaggaaaccattgaccgcgagacttctggcaatttagagcaactactccttgctgtt
gtgaaatctattcgaagtatacctgcctaccttgcagagaccctctattatgctatgaag
ggagctgggacagatgatcataccctcatcagagtcatggtttccaggagtgagattgat
ctgtttaacatcaggaaggagtttaggaagaattttgccacctctctttattccatgatt
aagggagatacatctggggactataagaaagctcttctgctgctctgtggagaagatgac
taa

DBGET integrated database retrieval system