KEGG   Homo sapiens (human): 30814
Entry
30814             CDS       T01001                                 

Gene name
PLA2G2E, GIIE_sPLA2, sPLA2-IIE
Definition
(RefSeq) phospholipase A2 group IIE
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    30814 (PLA2G2E)
   00565 Ether lipid metabolism
    30814 (PLA2G2E)
   00590 Arachidonic acid metabolism
    30814 (PLA2G2E)
   00591 Linoleic acid metabolism
    30814 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    30814 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    30814 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    30814 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    30814 (PLA2G2E)
   04975 Fat digestion and absorption
    30814 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    30814 (PLA2G2E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     30814 (PLA2G2E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    30814 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 30814
NCBI-ProteinID: NP_055404
OMIM: 618320
HGNC: 13414
Ensembl: ENSG00000188784
Vega: OTTHUMG00000002702
Pharos: Q9NZK7(Tchem)
UniProt: Q9NZK7
Structure
PDB: 

Position
1p36.13
AA seq 142 aa
MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNL
GTYNRKYAHYPNKLCTGPTPPC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaaatctccccacgtgctggtgttcctttgcctcctggtggctctggtcaccgggaac
ctggttcagtttggggtgatgatcgagaagatgacaggcaagtccgccctgcagtacaac
gactatggctgttactgcggcatcggtggctcccactggccggtggaccagactgactgg
tgctgccacgcccacgactgctgctacgggcgtctggagaagctgggctgtgagcccaaa
ctggaaaagtatcttttctctgtcagcgaacgtggcattttctgcgccggcaggaccacc
tgccagcggctgacctgcgagtgtgacaagagggctgccctctgctttcgccgcaacctg
ggcacctacaaccgcaaatatgcccattatcccaacaagctgtgcaccgggcccaccccg
ccctgctga

DBGET integrated database retrieval system