KEGG   Homo sapiens (human): 3083Help
Entry
3083              CDS       T01001                                 

Gene name
HGFAC, HGFA
Definition
(RefSeq) HGF activator
  KO
K09631  hepatocyte growth factor activator [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3083 (HGFAC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     3083 (HGFAC)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   3083 (HGFAC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle fn2 EGF fn1 DUF1986 hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 3083
NCBI-ProteinID: NP_001519
OMIM: 604552
HGNC: 4894
Ensembl: ENSG00000109758
Vega: OTTHUMG00000090281
Pharos: Q04756(Tchem)
UniProt: Q04756
Structure
PDB: 

Position
4p16.3
AA seq 655 aa AA seqDB search
MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILV
TSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLH
ACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQD
PQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECFGGRTWCEGT
RHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNIEPDERCFLGNGTGYRGVAST
SASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWE
YCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP
WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIE
KYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGW
GHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGG
PLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggggcgctgggcctgggtccccagcccctggcccccaccggggctgggccccttcctc
ctcctcctcctgctgctgctgctgctgccacgggggttccagccccagcctggcgggaac
cgtacggagtccccagaacctaatgccacagcgacccctgcgatccccactatcctggtg
acctctgtgacctctgagaccccagcaacaagtgctccagaggcagagggaccccaaagt
ggggggctcccgcccccgcccagggcagttccctcgagcagtagcccccaggcccaagca
ctcaccgaggacgggaggccctgcaggttccccttccgctacgggggccgcatgctgcat
gcctgcacttcggagggcagtgcacacaggaagtggtgtgccacaactcacaactacgac
cgggacagggcctggggctactgtgtggaggccaccccgcctccagggggcccagctgcc
ctggatccctgtgcctccggcccctgcctcaatggaggctcctgctccaatacccaggac
ccccagtcctatcactgcagctgcccccgggccttcaccggcaaggactgcggcacagag
aaatgctttgatgagacccgctacgagtacctggaggggggcgaccgctgggcccgcgtg
cgccagggccacgtggaacagtgcgagtgcttcgggggccggacctggtgcgaaggcacc
cgacatacagcttgtctgagcagcccttgcctgaacgggggcacctgccacctgatcgtg
gccaccgggaccaccgtgtgtgcctgcccaccaggcttcgctggacggctctgcaacatc
gagcctgatgagcgctgcttcttggggaacggcactgggtaccgtggcgtggccagcacc
tcagcctcgggcctcagctgcctggcctggaactccgatctgctctaccaggagctgcac
gtggactccgtgggcgccgcggccctgctgggcctgggcccccatgcctactgccggaat
ccggacaatgacgagaggccctggtgctacgtggtgaaggacagcgcgctctcctgggag
tactgccgcctggaggcctgcgaatccctcaccagagtccaactgtcaccggatctcctg
gcgaccctgcctgagccagcctccccggggcgccaggcctgcggcaggaggcacaagaag
aggacgttcctgcggccacgtatcatcggcggctcctcctcgctgcccggctcgcacccc
tggctggccgccatctacatcggggacagcttctgcgccgggagcctggtccacacctgc
tgggtggtgtcggccgcccactgcttctcccacagcccccccagggacagcgtctccgtg
gtgctgggccagcacttcttcaaccgcacgacggacgtgacgcagaccttcggcatcgag
aagtacatcccgtacaccctgtactcggtgttcaaccccagcgaccacgacctcgtcctg
atccggctgaagaagaaaggggaccgctgtgccacacgctcgcagttcgtgcagcccatc
tgcctgcccgagcccggcagcaccttccccgcaggacacaagtgccagattgcgggctgg
ggccacttggatgagaacgtgagcggctactccagctccctgcgggaggccctggtcccc
ctggtcgccgaccacaagtgcagcagccctgaggtctacggcgccgacatcagccccaac
atgctctgtgccggctacttcgactgcaagtccgacgcctgccagggggactcagggggg
cccctggcctgcgagaagaacggcgtggcttacctctacggcatcatcagctggggtgac
ggctgcgggcggctccacaagccgggggtctacacccgcgtggccaactatgtggactgg
atcaacgaccggatacggcctcccaggcggcttgtggctccctcctga

DBGET integrated database retrieval system