KEGG   Homo sapiens (human): 30837
Entry
30837             CDS       T01001                                 

Gene name
SOCS7, NAP4, NCKAP4
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  JAK-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    30837 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    30837 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    30837 (SOCS7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     30837 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 30837
NCBI-ProteinID: NP_055413
OMIM: 608788
HGNC: 29846
Ensembl: ENSG00000274211
Vega: OTTHUMG00000188546
Pharos: O14512(Tbio)
UniProt: O14512
Position
17q12
AA seq 645 aa
MQEAELRDGEAAAAAASYRVLSRLLGYGEAAPEPGPPPPPPGHGPPPPPFLARPGPRGSR
PPQLMVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGL
EAQLAALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLV
LEGLESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLS
RGEQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKR
PSGELAASAASLTDMGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDIS
QRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAF
PRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKG
KPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIK
RAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIP
DLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgcaggaggccgagctccgggatggcgaggcggcggcggcggccgcttcgtaccgcgtc
ctgagccgcctccttggctatggagaggcggcccccgagccaggccctccgccaccgccc
ccgggccatggccccccgccgccacccttcctcgcgcggcccggcccgcggggctcccgg
ccgccgcagctgatggtgttccgcaacgtgggtcggccgccggaggaggaggacgtggag
gcggccccggagccgggaccctcggaactgctgtgtccccggcaccgctgtgccctggac
cccaaggccctgccgccgggcttggcgctcgagcggacctggggcccggcggctggacta
gaggcgcagttggcggctctggggctcgggcagccggcggggccgggggtcaagacagtc
ggtgggggttgctgcccgtgtccgtgtcctcctcagccgccccctccgcagccccagccg
cctgctgccgccccgcaggccggggaggaccccacggaaacgagcgacgcgctgctggtc
ctggagggcttggaatcggaggccgagagcctggagactaacagctgctcggaagaggag
ctcagcagcccgggtcgcggaggaggagggggcggccggcttctgctgcagcccccaggc
cctgaattacctccggtgcccttcccgctgcaggacttggtccctctggggcgcctgagt
agaggggagcagcagcagcagcagcagcagcaacctcccccgcccccgcctcctcccggg
cccctccggccactcgcgggtccttctcggaagggctccttcaaaatccgcctcagtcgc
ctctttcgcaccaagagctgcaacggtggctccggcggtggggatgggaccggcaagagg
ccttctggagagctggctgcttcagctgcgagcctgacagacatgggaggctctgcgggc
cgggagctggacgcggggaggaaacccaagttgacaagaactcaaagtgccttttctccg
gtctccttcagccccctgttcacaggtgaaactgtgtcgcttgtggatgtggacatttct
cagcggggcctgacctctccacaccctccaactccccctcctcctccgagaagaagcctc
agcctcctagatgatatcagtgggacgctgcctacatctgtccttgtggctccgatgggg
tcttccttgcagtctttccccctacctccgcctcctccaccccatgccccagatgcattt
ccccggattgctcccatccgagcagctgaatccctgcacagccaacccccacagcacctc
cagtgtcccctctaccggcctgactcgagcagctttgcagccagccttcgagagttggag
aagtgtggttggtattgggggccaatgaattgggaagatgcagagatgaagctgaaaggg
aaaccagatggttctttcctggtacgagacagttctgatcctcgttacatcctgagcctc
agtttccgatcacagggtatcacccaccacactagaatggagcactacagaggaaccttc
agcctgtggtgtcatcccaagtttgaggaccgctgtcaatctgttgtagagtttattaag
agagccattatgcactccaagaatggaaagtttctctatttcttaagatccagggttcca
ggactgccaccaactcctgtccagctgctctatccagtgtcccgattcagcaatgtcaaa
tccctccagcacctttgcagattccggatacgacagctcgtcaggatagatcacatccca
gatctcccactgcctaaacctctgatctcttatatccgaaagttctactactatgatcct
caggaagaggtatacctgtctctaaaggaagcgcagctcatttccaaacagaagcaagag
gtggaaccctccacgtag

DBGET integrated database retrieval system