KEGG   Homo sapiens (human): 30848
Entry
30848             CDS       T01001                                 
Symbol
CTAG2, CAMEL, CT2, CT6.2, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE2B
Name
(RefSeq) cancer/testis antigen 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Pcc1
Other DBs
NCBI-GeneID: 30848
NCBI-ProteinID: NP_066274
OMIM: 300396
HGNC: 2492
Ensembl: ENSG00000126890
Pharos: O75638(Tbio)
UniProt: O75638
Position
X:complement(154651977..154653579)
AA seq 210 aa
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGA
PRGPHGGAASAQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPG
AVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRP
GTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcaggccgaaggccggggcacagggggttcgacgggcgatgctgatggcccaggaggc
cctggcattcctgatggcccagggggcaatgctggcggcccaggagaggcgggtgccacg
ggcggcagaggtccccggggcgcaggggcagcaagggcctcggggccgagaggaggcgcc
ccgcggggtccgcatggcggtgccgcttctgcgcaggatggaaggtgcccctgcggggcc
aggaggccggacagccgcctgcttgagttgcacatcacgatgcctttctcgtcgcccatg
gaagcggagctggtccgcaggatcctgtcccgggatgccgcaccgctcccccgaccaggg
gcggttctgaaggacttcaccgtgtccggcaacctactgtttatgtcagttcgggaccag
gacagggaaggcgctgggcggatgagggtggtgggttgggggctgggatccgcctccccg
gaggggcagaaagctagagatctcagaacacccaaacacaaggtctcagaacagagacct
ggtacaccaggcccgccgccacccgagggagcccagggagatgggtgcagaggtgtcgcc
tttaatgtgatgttctctgcccctcacatttag

DBGET integrated database retrieval system