KEGG   Homo sapiens (human): 30849Help
Entry
30849             CDS       T01001                                 

Gene name
PIK3R4, VPS15, p150
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 4
  KO
K08333  phosphoinositide-3-kinase, regulatory subunit 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04371  Apelin signaling pathway
Network
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    30849 (PIK3R4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    30849 (PIK3R4)
   04136 Autophagy - other
    30849 (PIK3R4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    30849 (PIK3R4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    30849 (PIK3R4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     30849 (PIK3R4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  VPS15 family
   30849 (PIK3R4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    30849 (PIK3R4)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    30849 (PIK3R4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase WD40 HEAT Pkinase_Tyr HEAT_2 IFRD
Motif
Other DBs
NCBI-GeneID: 30849
NCBI-ProteinID: NP_055417
OMIM: 602610
HGNC: 8982
Ensembl: ENSG00000196455
Vega: OTTHUMG00000159645
Pharos: Q99570(Tbio)
UniProt: Q99570
Position
3q22.1
AA seq 1358 aa AA seqDB search
MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDP
TLPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFL
NNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMD
IFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDK
RLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITP
YLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRL
AYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDS
IVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDI
APFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVL
KEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMT
EEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEP
DDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICV
PLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERI
AKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIW
NSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSP
KIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLK
SGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWV
IAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAG
SDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRG
PESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcagcttgctggcattgctccctcccagatcctttctgtagagagttatttt
tcagatattcatgactttgaatatgataaaagcctggggagtactcggttttttaaagtt
gctcgagccaagcaccgagaaggcctggtcgttgtgaaggtttttgcaattcaggatccc
acattgcctttaaccagctataaacaagagctggaggaactgaaaatcaggcttaattct
gcacagaattgtctacctttccagaaagcatcagaaaaagcatctgagaaagcagctatg
ctctttaggcagtatgtgcgagacaatctctatgatcgcatcagtacccgtccattcttg
aataacattgagaagcgctggattgctttccagatcctgacagctgtggaccaagcacac
aaatctggagttcgtcatggggacatcaagactgagaatgtgatggtcaccagttggaat
tgggttcttctaactgattttgccagttttaagcccacttatcttccagaagacaacccg
gcagatttcaattatttctttgacacatcacggaggagaacttgctatattgctcctgaa
cgttttgttgatggtgggatgtttgccactgagttagaatatatgagagatccttcaact
ccgcttgtagacttaaatagcaatcagagaacaagaggagagttgaagagagcaatggac
atcttttcagcaggttgtgtgatagctgagctttttacagaaggtgtaccattatttgat
ctctctcaacttttggcttatagaaatggacattttttccctgaacaagtgctaaataaa
attgaagatcacagtatcagagaattggtaactcagatgattcaccgtgagccagataaa
cgtttagaggcagaagattacttaaaacagcagcgtggcaatgcctttcctgaaatattt
tacacttttcttcagccctacatggcccagtttgccaaggaaacgtttctttctgcagat
gagcgtattctggttatacggaaggatttgggcaacattattcacaatctctgtggacat
gatctgccagaaaaagccgaaggagagcctaaggaaaatgggctggttatcttggtatct
gttataacatcctgcctacagacccttaaatactgtgattccaaactagctgctttggaa
ctgattcttcatttggctccaagattaagtgttgaaatccttttggatcgtattactcca
tatcttttgcatttcagcaatgactctgttcctagggtgagggctgaagccttgaggacg
ttgaccaaagttcttgctctcgtcaaagaggttcctcgtaatgatatcaatatttatccg
gaatacattctgccaggcatagcccacttagcccaagatgatgctactatcgttagacta
gcctatgctgaaaacatagctctgctggcagaaacagctctgagattcctggaattagta
cagttaaaaaatcttaatatggaaaatgaccccaataatgaagaaatagatgaggttaca
catccaaatggaaattatgacacagagctccaagccttacatgaaatggtccagcagaaa
gttgttactttgctaagtgaccctgaaaatattgtaaaacaaaccttgatggaaaatgga
ataacacggctgtgtgtattctttggacgtcagaaagccaacgatgttttgttgtcccac
atgattactttcctaaatgataagaatgattggcatctacgtggagcattttttgatagt
atagttggtgttgctgcctatgttggctggcaaagctcctcaattctcaagcctctgctg
caacaaggtcttagtgatgctgaggaatttgtcattgtgaaagctctttatgcccttact
tgtatgtgccagttaggactgctacaaaaaccccatgtttacgaatttgccagtgatatt
gcccccttcctgtgtcatcccaatttatggatacgttatggtgccgtgggatttatcaca
gtggtagctcgtcaaataagtacagctgatgtctactgtaaactgatgccttatcttgac
ccatatattacccaaccaataatacagattgaaagaaaacttgttctgctcagtgtttta
aaggaaccagtaagtcgttctatatttgattatgctttgaggtctaaagatattactagc
ttgttcagacatcttcacatgcgtcagaagaaacgaaatggttctcttcccgactgccct
ccgccagaggatcctgccatagcacagcttctgaagaagttgctctcacagggaatgaca
gaggaagaggaagacaaacttctggcactgaaagacttcatgatgaaatctaataaagca
aaggccaatatagtggaccagagccatcttcatgatagtagtcagaaaggtgtaattgac
ttggcagctttaggcataactgggagacaagttgatcttgttaaaaccaaacaagaacca
gatgacaaacgggccagaaaacatgtaaaacaagactcaaatgtaaatgaagaatggaaa
agcatgtttgggtcactggacccaccaaacatgccacaggccctacctaaagggagtgat
caggaggtgattcagactgggaaacctcctcgttccgagtcctctgctggcatttgtgtc
cctttgtcaacttcttcacaggttccagaagtgacaactgtccaaaataaaaaaccagta
ataccggttttaagtagtacaatcttaccatccacctatcagattcgaattacaacttgt
aaaactgaacttcagcaactcatccagcaaaagcgggagcagtgcaatgctgagagaata
gctaagcagatgatggaaaatgctgaatgggagagtaaaccaccaccacctggatggcgt
cctaaagggctgttagttgcccatcttcatgagcataaatctgctgtgaatcgaattaga
gtctctgatgaacactcactttttgcaacatgttcaaatgatggcacagtgaaaatctgg
aacagtcaaaagatggaggggaagaccaccactaccagatctattcttacatacagccga
attggaggacgagtcaagacgctcacattctgccaaggctcccactatttagccatagca
tctgataatggtgctgtccagcttcttggaattgaggcttctaagctgcccaagtctcct
aaaatccatcctctacaaagcagaattctagatcagaaggaggacggttgtgttgtggat
atgcatcacttcaactctggagcacagtctgttcttgcctatgccactgtgaatggctct
ctggttggctgggaccttaggtcttcaagcaatgcgtggactttaaagcatgatttaaag
tcgggcctcatcacttcctttgctgtggacatccaccaatgctggctctgcattggtaca
agcagtggtaccatggcttgttgggacatgaggttccagttgccaatttcaagtcactgt
catccttccagggctcgaatcagacgcctctcaatgcaccctctgtatcagtcctgggtg
attgcagctgttcagggcaacaacgaagtgtccatgtgggacatggagactggtgacaga
agatttactctctgggccagcagtgcaccaccactttctgaattacagccttctcctcat
agcgtccatggtatctactgtagtcctgcagatggaaatcctatcctactaacagctggc
tcagatatgaaaataaggttttgggacttggcttacccagaaaggtcctatgttgttgca
ggaagtactagttccccatctgtgtcctactacaggaaaataattgaaggcactgaagtt
gtccaggaaattcagaataagcagaaagtaggaccaagtgatgacacccctcgaaggggc
ccagagtccctgcccgtgggacatcatgacatcatcactgatgtcgccacattccagacc
acacagggcttcatcgtaactgcttctagagatgggattgtgaaggtgtggaaataa

DBGET integrated database retrieval system