KEGG   Homo sapiens (human): 30850
Entry
30850             CDS       T01001                                 
Symbol
CDR2L, HUMPPA
Name
(RefSeq) cerebellar degeneration related protein 2 like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF1664 ZapB THOC7 FliD_C Occludin_ELL
Other DBs
NCBI-GeneID: 30850
NCBI-ProteinID: NP_055418
HGNC: 29999
Ensembl: ENSG00000109089
Pharos: Q86X02(Tdark)
UniProt: Q86X02 A0A024R8R6
Position
17:74987632..75005800
AA seq 465 aa
MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQV
QEIEYLTKQLDTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIE
RLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSS
LELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELERQLCEMEAC
RLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQD
GVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQY
HALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQ
HVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgcggagagccgccgggatggaggacttctccgcggaggaagaggagtcctggtacgac
cagcaggacctggagcaggacttgcacctagctgcggagctggggaagactctgctggag
aggaacaaggagctggaggggtccctgcagcagatgtactccaccaatgaggaacaggtg
caggagatcgagtacctaaccaagcagctggacacgctgcggcacgtgaacgagcagcac
gccaaagtctatgagcagctggacctgacagcccgggacctggagctgaccaaccacagg
ctggtgctggagagtaaggctgcccagcagaagatccatgggctgacggagaccattgag
cgcctccaggctcaggtggaggagctgcaggcccaggtggagcaactgagaggcctggaa
cagctgcgagtgctccgggagaagcgggaacgcaggcgtaccatccacaccttcccctgc
ctcaaggagctgtgcaccagcccccggtgcaaggatgctttccgcctacacagttcctcc
ctggagctgggcccgcggcccctggagcaggagaacgagcggctgcagaccctggtgggg
gcgctgcgctcccaggtgagccaggagcggcagcgcaaggagcgggcggagcgcgagtac
accgcggtgctgcaggagtactcggagctggagcgccagctgtgcgagatggaggcctgt
cgcctgcgtgtgcaggagctggaggccgagctgctggagctgcagcagatgaagcaggcc
aagacctacctactgggtccggacgaccacctggccgaggccctgctcgcacccctcacg
caggcccctgaggccgacgatccccagcccggccgcggggacgacttgggcgcccaggac
ggggtctcctcaccggcagcctctccaggccacgtggtgcgcaagagctgcagcgacact
gcgctcaacgccatcgtggccaaagacccagccagccggcacgcgggcaacctcacactg
cacgccaacagcgtgcgcaagcggggcatgtccatcctgcgggaggtggacgagcagtac
cacgcgctgctggagaagtacgaggagctgctgagcaagtgccggcagcacggggccgga
gtgcggcacgccggcgtgcagacctcgcgccccatctcccgggacagctcgtggagggac
ctgcgcgggggtgaggagggccagggtgaggtcaaggcaggagagaagagcctgagccag
cacgtggaggccgtggacaagcggctggaacagagccagcccgagtacaaggcgctcttc
aaagagatcttctccaggatccagaagaccaaggctgacatcaacgccaccaaagtcaag
acgcacagcagcaagtga

DBGET integrated database retrieval system