KEGG   Homo sapiens (human): 3087Help
Entry
3087              CDS       T01001                                 

Gene name
HHEX, HEX, HMPH, HOX11L-PEN, PRH, PRHX
Definition
(RefSeq) hematopoietically expressed homeobox
  KO
K08024  homeobox protein HEX
Organism
hsa  Homo sapiens (human)
Pathway
hsa04950  Maturity onset diabetes of the young
hsa05202  Transcriptional misregulation in cancer
Network
N00121  LMO2-rearrangement to transcriptional activation
Disease
H00409  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    3087 (HHEX)
  09166 Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3087 (HHEX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3087 (HHEX)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    3087 (HHEX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 3087
NCBI-ProteinID: NP_002720
OMIM: 604420
HGNC: 4901
Ensembl: ENSG00000152804
Vega: OTTHUMG00000018762
Pharos: Q03014(Tbio)
UniProt: Q03014
Structure
PDB: 

Position
10q23.33
AA seq 270 aa AA seqDB search
MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTS
LVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPL
GKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ
VKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSP
ASQEDLESEISEDSDQEVDIEGDKSYFNAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacccgcaccccgggccggcggcgggcgccgtgggggtgccgctgtacgcgccc
acgccgctgctgcaacccgcacacccgacgcccttttacatcgaggacatcctgggccgc
gggcccgccgcgcccacgcccgcccccacgctgccgtcccccaactcctccttcaccagc
ctcgtgtccccctaccggaccccggtgtacgagcccacgccgatccatccagccttctcg
caccactccgccgccgcgctggccgctgcctacggacccggcggcttcgggggccctctg
taccccttcccgcggacggtgaacgactacacgcacgccctgctccgccacgaccccctg
ggcaaacctctactctggagccccttcttgcagaggcctctgcataaaaggaaaggcggc
caggtgagattctccaacgaccagaccatcgagctggagaagaaattcgagacgcagaaa
tatctctctccgcccgagaggaagcgtctggccaagatgctgcagctcagcgagagacag
gtcaaaacctggtttcagaatcgacgcgctaaatggaggagactaaaacaggagaaccct
caaagcaataaaaaagaagaactggaaagtttggacagttcctgtgatcagaggcaagat
ttgcccagtgaacagaataaaggtgcttctttggatagctctcaatgttcgccctcccct
gcctcccaggaagaccttgaatcagagatttcagaggattctgatcaggaagtggacatt
gagggcgataaaagctattttaatgctggatga

DBGET integrated database retrieval system