KEGG   Homo sapiens (human): 309Help
Entry
309               CDS       T01001                                 

Gene name
ANXA6, ANX6, CBP68, CPB-II, p68, p70
Definition
(RefSeq) annexin A6
  KO
K17094  annexin A6
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    309 (ANXA6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   309 (ANXA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 309
NCBI-ProteinID: NP_001146
OMIM: 114070
HGNC: 544
Ensembl: ENSG00000197043
Vega: OTTHUMG00000164179
Pharos: P08133(Tbio)
UniProt: P08133 A0A0S2Z2Z6
Structure
PDB: 

Position
5q33.1
AA seq 673 aa AA seqDB search
MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQ
SYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILA
SRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQD
VQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEK
LMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKS
LYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVARVELKGTVRPA
NDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKED
YHKSLEDALSSDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK
TSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNK
PLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGD
FLKALLALCGGED
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccagcacagggtgccaagtaccggggctccatccatgacttcccaggcttt
gaccccaaccaggatgccgaggctctgtacactgccatgaagggctttggcagtgacaag
gaggccatactggacataatcacctcacggagcaacaggcagaggcaggaggtctgccag
agctacaagtccctctacggcaaggacctcattgctgatttaaagtatgaattgacgggc
aagtttgaacggttgattgtgggcctgatgaggccacctgcctattgtgatgccaaagaa
attaaagatgccatctcgggcattggcactgatgagaagtgcctcattgagatcttggct
tcccggaccaatgagcagatgcaccagctggtggcagcatacaaagatgcctacgagcgg
gacctggaggctgacatcatcggcgacacctctggccacttccagaagatgcttgtggtc
ctgctccagggaaccagggaggaggatgacgtagtgagcgaggacctggtacaacaggat
gtccaggacctatacgaggcaggggaactgaaatggggaacagatgaagcccagttcatt
tacatcttgggaaatcgcagcaagcagcatcttcggttggtgttcgatgagtatctgaag
accacagggaagccgattgaagccagcatccgaggggagctgtctggggactttgagaag
ctaatgctggccgtagtgaagtgtatccggagcaccccggaatattttgctgaaaggctc
ttcaaggctatgaagggcctggggactcgggacaacaccctgatccgcatcatggtctcc
cgtagtgagttggacatgctcgacattcgggagatcttccggaccaagtatgagaagtcc
ctctacagcatgatcaagaatgacacctctggcgagtacaagaagactctgctgaagctg
tctgggggagatgatgatgctgctggccagttcttcccggaggcagcgcaggtggcctat
cagatgtgggaacttagtgcagtggcccgagtagagctgaagggaactgtgcgcccagcc
aatgacttcaaccctgacgcagatgccaaagcgctgcggaaagccatgaagggactcggg
actgacgaagacacaatcatcgatatcatcacgcaccgcagcaatgtccagcggcagcag
atccggcagaccttcaagtctcactttggccgggacttaatgactgacctgaagtctgag
atctctggagacctggcaaggctgattctggggctcatgatgccaccggcccattacgat
gccaagcagttgaagaaggccatggagggagccggcacagatgaaaaggctcttattgaa
atcctggccactcggaccaatgctgaaatccgggccatcaatgaggcctataaggaggac
tatcacaagtccctggaggatgctctgagctcagacacatctggccacttcaggaggatc
ctcatttctctggccacggggcatcgtgaggagggaggagaaaacctggaccaggcacgg
gaagatgcccaggtggctgctgagatcttggaaatagcagacacacctagtggagacaaa
acttccttggagacacgtttcatgacgatcctgtgtacccggagctatccgcacctccgg
agagtcttccaggagttcatcaagatgaccaactatgacgtggagcacaccatcaagaag
gagatgtctggggatgtcagggatgcatttgtggccattgttcaaagtgtcaagaacaag
cctctcttctttgccgacaaactttacaaatccatgaagggtgctggcacagatgagaag
actctgaccaggatcatggtatcccgcagtgagattgacctgctcaacatccggagggaa
ttcattgagaaatatgacaagtctctccaccaagccattgagggtgacacctccggagac
ttcctgaaggccttgctggctctctgtggtggtgaggactag

DBGET integrated database retrieval system