KEGG   Homo sapiens (human): 3090Help
Entry
3090              CDS       T01001                                 

Gene name
HIC1, ZBTB29, ZNF901, hic-1
Definition
(RefSeq) HIC ZBTB transcriptional repressor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-met zf-C2H2_3rep zf-C2H2_11 zf-Di19 Zn-ribbon_8 LIM
Motif
Other DBs
NCBI-GeneID: 3090
NCBI-ProteinID: NP_001091672
OMIM: 603825
HGNC: 4909
Ensembl: ENSG00000177374
Vega: OTTHUMG00000177635
Pharos: Q14526(Tbio)
UniProt: Q14526
Position
17p13.3
AA seq 733 aa AA seqDB search
MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRA
HKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAP
GAEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRA
ATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLC
GLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEA
APPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERG
GDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAA
GLGPPFGGGGDKVAGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTIC
GKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKF
AQQRNLISHMKMHAVGGAAGAAGALAGLGGLPGVPGPDGKGKLDFPEGVFAVARLTAEQL
SLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAA
GPDGRTIDRFSPT
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcctgaagcggacattttacttaaatcgggagagtgtgctgggcagacgatg
ctggacacgatggaggcgcccggccactccaggcagctgctgctgcagctcaacaaccag
cgcaccaagggcttcttgtgcgacgtgatcatcgtggtgcagaacgccctcttccgcgcg
cacaagaacgtgctggcggccagcagcgcctacctcaagtccctggtggtgcatgacaac
ctgctcaacctggaccatgacatggtgagcccggccgtgttccgcctggtgctggacttc
atctacaccggccgcctggctgacggcgcagaggcggctgcggccgcggccgtggccccg
ggggctgagccgagcctgggcgccgtgctggccgccgccagctacctgcagatccccgac
ctcgtggcgctgtgcaagaaacgcctcaagcgccacggcaagtactgccacctgcggggc
ggcggcggcggcggcggcggctacgcgccctatggtcggccgggccggggcctgcgggcc
gccacgccggtcatccaggcctgctacccgtccccagtcgggcctccgccgccgcctgcc
gcggagccgccctcgggcccagaggccgcggtcaacacgcactgcgccgagctgtacgcg
tcgggacccggcccggccgccgcactctgtgcctcggagcgccgctgctcccctctttgt
ggcctggacctgtccaagaagagcccgccgggctccgcggcgccagagcggccgctggct
gagcgcgagctgcccccgcgcccggacagccctcccagcgccggccccgccgcctacaag
gagccgcctctcgccctgccgtcgctgccgccgctgcccttccagaagctggaggaggcc
gcaccgccttccgacccatttcgcggcggcagcggcagcccgggacccgagccccccggc
cgccccgacgggcctagtctcctctatcgctggatgaagcacgagccgggcctgggtagc
tatggcgacgagctgggccgggagcgcggctcccccagcgagcgctgcgaagagcgtggt
ggggacgcggccgtctcgcccggggggcccccgctcggcctggcgccgccgccgcgctac
cctggcagcctggacgggcccggcgcgggcggcgacggcgacgactacaagagcagcagc
gaggagaccggtagcagcgaggaccccagcccgcctggcggccacctcgagggctaccca
tgcccgcacctggcctatggcgagcccgagagcttcggtgacaacctgtacgtgtgcatt
ccgtgcggcaagggcttccccagctctgagcagctgaacgcgcacgtggaggctcacgtg
gaggaggaggaagcgctgtacggcagggccgaggcggccgaagtggccgctggggccgcc
ggcctagggcccccttttggaggcggcggggacaaggtcgccggggctccgggtggcctg
ggagagctgctgcggccctaccgctgcgcgtcgtgcgacaagagctacaaggacccggcc
acgctgcggcagcacgagaagacgcactggctgacccggccctacccatgcaccatctgc
gggaagaagttcacgcagcgtgggaccatgacgcgccacatgcgcagccacctgggcctc
aagcccttcgcgtgcgacgcgtgcggcatgcggttcacgcgccagtaccgcctcacggag
cacatgcgcatccactcgggcgagaagccctacgagtgccaggtgtgcggcggcaagttc
gcacagcaacgcaacctcatcagccacatgaagatgcacgccgtggggggcgcggccggc
gcggccggggcgctggcgggcttgggggggctccccggcgtccccggccccgacggcaag
ggcaagctcgacttccccgagggcgtctttgctgtggctcgcctcacggccgagcagctg
agcctgaagcagcaggacaaggcggccgcggccgagctgctggcgcagaccacgcacttc
ctgcacgaccccaaggtggcgctggagagcctctacccgctggccaagttcacggccgag
ctgggcctcagccccgacaaggcggccgaggtgctgagccagggcgctcacctggcggcc
gggcccgacggccggaccatcgaccgtttctctcccacctag

DBGET integrated database retrieval system