KEGG   Homo sapiens (human): 3092Help
Entry
3092              CDS       T01001                                 

Gene name
HIP1, HIP-I, ILWEQ, SHON, SHONbeta, SHONgamma
Definition
(RefSeq) huntingtin interacting protein 1
  KO
K04559  huntingtin interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    3092 (HIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3092 (HIP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    3092 (HIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANTH I_LWEQ HIP1_clath_bdg Filament CENP-K NACHT_N HOOK Ribosomal_S2
Motif
Other DBs
NCBI-GeneID: 3092
NCBI-ProteinID: NP_005329
OMIM: 601767
HGNC: 4913
Ensembl: ENSG00000127946
Vega: OTTHUMG00000156050
Pharos: O00291(Tbio)
UniProt: O00291 B4DK46
Structure
PDB: 

Position
7q11.23
AA seq 1037 aa AA seqDB search
MDRMASSMKQVPNPLPKVLSRRGVGAGLEAAERESFERTQTVSINKAINTQEVAVKEKHA
RTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVLKDSLRYRNE
LSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFPGNLQMSDRQLDEAGESDVNN
FFQLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTV
KLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLR
ASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPF
NFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQ
HLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEKYSELVQ
NHADLLRKNAEVTKQVSMARQAQVDLEREKKELEDSLERISDQGQRKTQEQLEVLESLKQ
ELATSQRELQVLQGSLETSAQSEANWAAEFAELEKERDSLVSGAAHREEELSALRKELQD
TQLKLASTEESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISCAGSADHLLST
VTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDAIAHGATTCLRAPPEPADS
LTEACKQYGRETLAYLASLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGLDIKQEELG
DLVDKEMAATSAAIETATARIEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVA
SKDLQREIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKF
EELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKSQI
EETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEE
GTEASPPTLQEVVTEKE
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggatcggatggccagctccatgaagcaggtgcccaacccactgcccaaggtgctgagc
cggcgcggggtcggcgctgggctggaggcggcggagcgcgagagcttcgagcggactcag
actgtcagcatcaataaggccattaatacgcaggaagtggctgtaaaggaaaaacacgcc
agaacgtgcatactgggcacccaccatgagaaaggggcacagaccttctggtctgttgtc
aaccgcctgcctctgtctagcaacgcagtgctctgctggaagttctgccatgtgttccac
aaactcctccgagatggacacccgaacgtcctgaaggactctctgagatacagaaatgaa
ttgagtgacatgagcaggatgtggggccacctgagcgaggggtatggccagctgtgcagc
atctacctgaaactgctaagaaccaagatggagtaccacaccaaaaatcccaggttccca
ggcaacctgcagatgagtgaccgccagctggacgaggctggagaaagtgacgtgaacaac
tttttccagttaacagtggagatgtttgactacctggagtgtgaactcaacctcttccaa
acagtattcaactccctggacatgtcccgctctgtgtccgtgacggcagcagggcagtgc
cgcctcgccccgctgatccaggtcatcttggactgcagccacctttatgactacactgtc
aagcttctcttcaaactccactcctgcctcccagctgacaccctgcaaggccaccgggac
cgcttcatggagcagtttacaaagttgaaagatctgttctaccgctccagcaacctgcag
tacttcaagcggctcattcagatcccccagctgcctgagaacccacccaacttcctgcga
gcctcagccctgtcagaacatatcagccctgtggtggtgatccctgcagaggcctcatcc
cccgacagcgagccagtcctagagaaggatgacctcatggacatggatgcctctcagcag
aatttatttgacaacaagtttgatgacatctttggcagttcattcagcagtgatcccttc
aatttcaacagtcaaaatggtgtgaacaaggatgagaaggaccacttaattgagcgacta
tacagagagatcagtggattgaaggcacagctagaaaacatgaagactgagagccagcgg
gttgtgctgcagctgaagggccacgtcagcgagctggaagcagatctggccgagcagcag
cacctgcggcagcaggcggccgacgactgtgaattcctgcgggcagaactggacgagctc
aggaggcagcgggaggacaccgagaaggctcagcggagcctgtctgagatagaaaggaaa
gctcaagccaatgaacagcgatatagcaagctaaaggagaagtacagcgagctggttcag
aaccacgctgacctgctgcggaagaatgcagaggtgaccaaacaggtgtccatggccaga
caagcccaggtagatttggaacgagagaaaaaagagctggaggattcgttggagcgcatc
agtgaccagggccagcggaagactcaagaacagctggaagttctagagagcttgaagcag
gaacttgccacaagccaacgggagcttcaggttctgcaaggcagcctggaaacttctgcc
cagtcagaagcaaactgggcagccgagttcgccgagctagagaaggagcgggacagcctg
gtgagtggcgcagctcatagggaggaggaattatctgctcttcggaaagaactgcaggac
actcagctcaaactggccagcacagaggaatctatgtgccagcttgccaaagaccaacga
aaaatgcttctggtggggtccaggaaggctgcggagcaggtgatacaagacgccctgaac
cagcttgaagaacctcctctcatcagctgcgctgggtctgcagatcacctcctctccacg
gtcacatccatttccagctgcatcgagcaactggagaaaagctggagccagtatctggcc
tgcccagaagacatcagtggacttctccattccataaccctgctggcccacttgaccagc
gacgccattgctcatggtgccaccacctgcctcagagccccacctgagcctgccgactca
ctgaccgaggcctgtaagcagtatggcagggaaaccctcgcctacctggcctccctggag
gaagagggaagccttgagaatgccgacagcacagccatgaggaactgcctgagcaagatc
aaggccatcggcgaggagctcctgcccaggggactggacatcaagcaggaggagctgggg
gacctggtggacaaggagatggcggccacttcagctgctattgaaactgccacggccaga
atagaggagatgctcagcaaatcccgagcaggagacacaggagtcaaattggaggtgaat
gaaaggatccttggttgctgtaccagcctcatgcaagctattcaggtgctcatcgtggcc
tctaaggacctccagagagagattgtggagagcggcaggggtacagcatcccctaaagag
ttttatgccaagaactctcgatggacagaaggacttatctcagcctccaaggctgtgggc
tggggagccactgtcatggtggatgcagctgatctggtggtacaaggcagagggaaattt
gaggagctaatggtgtgttctcatgaaattgctgctagcacagcccagcttgtggctgca
tccaaggtgaaagctgataaggacagccccaacctagcccagctgcagcaggcctctcgg
ggagtgaaccaggccactgccggcgttgtggcctcaaccatttccggcaaatcacagatc
gaagagacagacaacatggacttctcaagcatgacgctgacacagatcaaacgccaagag
atggattctcaggttagggtgctagagctagaaaatgaattgcagaaggagcgtcaaaaa
ctgggagagcttcggaaaaagcactacgagcttgctggtgttgctgagggctgggaagaa
ggaacagaggcatctccacctacactgcaagaagtggtaaccgaaaaagaatag

DBGET integrated database retrieval system