KEGG   Homo sapiens (human): 3094
Entry
3094              CDS       T01001                                 

Gene name
HINT1, HINT, NMAN, PKCI-1, PRKCNH1
Definition
(RefSeq) histidine triad nucleotide binding protein 1
  KO
K02503  histidine triad (HIT) family protein
Organism
hsa  Homo sapiens (human)
Disease
H02390  Autosomal recessive neuromyotonia and axonal neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3094 (HINT1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3094 (HINT1)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 3094
NCBI-ProteinID: NP_005331
OMIM: 601314
HGNC: 4912
Ensembl: ENSG00000169567
Vega: OTTHUMG00000128995
Pharos: P49773(Tbio)
UniProt: P49773 A0A384NPU2
Structure
PDB: 

Position
5q23.3
AA seq 126 aa
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHI
SQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQ
MHWPPG
NT seq 381 nt   +upstreamnt  +downstreamnt
atggcagatgagattgccaaggctcaggtcgctcggcctggtggcgacacgatctttggg
aagatcatccgcaaggaaataccagccaaaatcatttttgaggatgaccggtgccttgct
ttccatgacatttcccctcaagcaccaacacattttctggtgatacccaagaaacatata
tcccagatttctgtggcagaagatgatgatgaaagtcttcttggacacttaatgattgtt
ggcaagaaatgtgctgctgatctgggcctgaataagggttatcgaatggtggtgaatgaa
ggttcagatggtggacagtctgtctatcacgttcatctccatgttcttggaggtcggcaa
atgcattggcctcctggttaa

DBGET integrated database retrieval system