KEGG   Homo sapiens (human): 3096Help
Entry
3096              CDS       T01001                                 

Gene name
HIVEP1, CIRIP, CRYBP1, GAAP, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A
Definition
(RefSeq) human immunodeficiency virus type I enhancer binding protein 1
  KO
K09239  human immunodeficiency virus type I enhancer-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3096 (HIVEP1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 large factors with NF-6B-like binding properties
    3096 (HIVEP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 3096
NCBI-ProteinID: NP_002105
OMIM: 194540
HGNC: 4920
Ensembl: ENSG00000095951
Vega: OTTHUMG00000014265
Pharos: P15822(Tbio)
UniProt: P15822
Structure
PDB: 

Position
6p24.1
AA seq 2718 aa AA seqDB search
MPRTKQIHPRNLRDKIEEAQKELNGAEVSKKEILQAGVKGTSESLKGVKRKKIVAENHLK
KIPKSPLRNPLQAKHKQNTEESSFAVLHSASESHKKQNYIPVKNGKQFTKQNGETPGIIA
EASKSEESVSPKKPLFLQQPSELRRWRSEGADPAKFSDLDEQCDSSSLSSKTRTDNSECI
SSHCGTTSPSYTNTAFDVLLKAMEPELSTLSQKGSPCAIKTEKLRPNKTARSPPKLKNSS
MDAPNQTSQELVAESQSSCTSYTVHMSAAQKNEQGAMQSASHLYHQHEHFVPKSNQHNQQ
LPGCSGFTGSLTNLQNQENAKLEQVYNIAVTSSVGLTSPSSRSQVTPQNQQMDSASPLSI
SPANSTQSPPMPIYNSTHVASVVNQSVEQMCNLLLKDQKPKKQGKYICEYCNRACAKPSV
LLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHKKSHAHTIKLGLVLQPDAGGLFLSHESP
KALSIHSDVEDSGESEEEGATDERQHDLGAMELQPVHIIKRMSNAETLLKSSFTPSSPEN
VIGDFLLQDRSAESQAVTELPKVVVHHVTVSPLRTDSPKAMDPKPELSSAQKQKDLQVTN
VQPLSANMSQGGVSRLETNENSHQKGDMNPLEGKQDSHVGTVHAQLQRQQATDYSQEQQG
KLLSPRSLGSTDSGYFSRSESADQTVSPPTPFARRLPSTEQDSGRSNGPSAALVTTSTPS
ALPTGEKALLLPGQMRPPLATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSI
DSPKSYIFKDSFQFDLKPVGRRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSN
SMPTTGYSAVPANIIPPPHPLRGSQSFDDKIGAFYDDVFVSGPNAPVPQSGHPRTLVRQA
AIEDSSANESHVLGTGQSLDESHQGCHAAGEAMSVRSKALAQGPHIEKKKSHQGRGTMFE
CETCRNRYRKLENFENHKKFYCSELHGPKTKVAMREPEHSPVPGGLQPQILHYRVAGSSG
IWEQTPQIRKRRKMKSVGDDEELQQNESGTSPKSSEGLQFQNALGCNPSLPKHNVTIRSD
QQHKNIQLQNSHIHLVARGPEQTMDPKLSTIMEQQISSAAQDKIELQRHGTGISVIQHTN
SLSRPNSFDKPEPFERASPVSFQELNRTGKSGSLKVIGISQEESHPSRDGSHPHQLALSD
ALRGELQESSRKSPSERHVLGQPSRLVRQHNIQVPEILVTEEPDRDLEAQCHDQEKSEKF
SWPQRSETLSKLPTEKLPPKKKRLRLAEIEHSSTESSFDSTLSRSLSRESSLSHTSSFSA
SLDIEDVSKTEASPKIDFLNKAEFLMIPAGLNTLNVPGCHREMRRTASEQINCTQTSMEV
SDLRSKSFDCGSITPPQTTPLTELQPPSSPSRVGVTGHVPLLERRRGPLVRQISLNIAPD
SHLSPVHPTSFQNTALPSVNAVPYQGPQLTSTSLAEFSANTLHSQTQVKDLQAETSNSSS
TNVFPVQQLCDINLLNQIHAPPSHQSTQLSLQVSTQGSKPDKNSVLSGSSKSEDCFAPKY
QLHCQVFTSGPSCSSNPVHSLPNQVISDPVGTDHCVTSATLPTKLIDSMSNSHPLLPPEL
RPLGSQVQKVPSSFMLPIRLQSSVPAYCFATLTSLPQILVTQDLPNQPICQTNHSVVPIS
EEQNSVPTLQKGHQNALPNPEKEFLCENVFSEMSQNSSLSESLPITQKISVGRLSPQQES
SASSKRMLSPANSLDIAMEKHQKRAKDENGAVCATDVRPLEALSSRVNEASKQKKPILVR
QVCTTEPLDGVMLEKDVFSQPEISNEAVNLTNVLPADNSSTGCSKFVVIEPISELQEFEN
IKSSTSLTLTVRSSPAPSENTHISPLKCTDNNQERKSPGVKNQGDKVNIQEQSQQPVTSL
SLFNIKDTQQLAFPSLKTTTNFTWCYLLRQKSLHLPQKDQKTSAYTDWTVSASNPNPLGL
PTKVALALLNSKQNTGKSLYCQAITTHSKSDLLVYSSKWKSSLSKRALGNQKSTVVEFSN
KDASEINSEQDKENSLIKSEPRRIKIFDGGYKSNEEYVYVRGRGRGKYICEECGIRCKKP
SMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKKCVDLGVSVGLIDEQDTE
ESDEKQRFSYERSGYDLEESDGPDEDDNENEDDDEDSQAESVLSATPSVTASPQHLPSRS
SLQDPVSTDEDVRITDCFSGVHTDPMDVLPRALLTRMTVLSTAQSDYNRKTLSPGKARQR
AARDENDTIPSVDTSRSPCHQMSVDYPESEEILRSSMAGKAVAITQSPSSVRLPPAAAEH
SPQTAAGMPSVASPHPDPQEQKQQITLQPTPGLPSPHTHLFSHLPLHSQQQSRTPYNMVP
VGGIHVVPAGLTYSTFVPLQAGPVQLTIPAVSVVHRTLGTHRNTVTEVSGTTNPAGVAEL
SSVVPCIPIGQIRVPGLQNLSTPGLQSLPSLSMETVNIVGLANTNMAPQVHPPGLALNAV
GLQVLTANPSSQSSPAPQAHIPGLQILNIALPTLIPSVSQVAVDAQGAPEMPASQSKACE
TQPKQTSVASANQVSRTESPQGLPTVQRENAKKVLNPPAPAGDHARLDGLSKMDTEKAAS
ANHVKPKPELTSIQGQPASTSQPLLKAHSEVFTKPSGQQTLSPDRQVPRPTALPRRQPTV
HFSDVSSDDDEDRLVIAT
NT seq 8157 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgaactaaacaaattcatcccagaaatctaagagacaaaattgaagaagcacaa
aaagaacttaatggggcagaagtttcaaaaaaagaaatcttacaggctggtgttaaagga
acttcggaatcccttaaaggtgtgaaacgcaaaaagatcgtagctgagaatcacctgaaa
aaaataccaaaatccccactgagaaatcctcttcaggcaaaacataaacaaaatacagaa
gagtcatctttcgccgttcttcatagtgcttcggagtctcacaagaaacagaattatatt
cctgtaaaaaatgggaagcagtttaccaaacaaaatggagaaacacctggaataattgct
gaagcctcaaaatctgaagaatctgtctccccaaagaagcccttgtttctgcagcaacca
tctgaactgcgtagatggagatccgaaggcgctgatcctgccaaattcagtgacctcgat
gaacaatgtgactcaagttccttgtcaagtaaaaccaggactgacaatagcgaatgcatc
tcttctcattgtggcactacgtccccctcctatacaaacactgcattcgatgtcttactg
aaagcaatggagccagaactgagcaccttgtcacaaaagggctcaccttgtgcaattaag
acagaaaaactgaggccaaataaaactgcacgttcccctcccaaattaaaaaacagttca
atggatgccccaaatcagacttcacaggaattggttgctgaatcacagtcttcttgtacc
tcatacacagtccatatgtctgctgctcagaagaatgagcaaggggcaatgcagtcagct
tctcatttgtatcatcaacatgaacactttgttcccaaatccaaccaacataatcaacag
cttccggggtgttcaggtttcacaggatcactgacaaatctgcaaaatcaagagaatgcc
aaacttgaacaggtttataatatagcagtgacatcatctgtaggcctaacttcaccttcc
agtagatctcaggttactcctcaaaaccagcaaatggattctgcttcacctttgtcaata
agtccggctaattctacacagtcgccccccatgccaatctataattcaactcatgttgcc
tctgttgttaatcaaagcgtagagcaaatgtgcaatcttcttctgaaagatcagaagcca
aaaaaacaaggaaaatatatttgtgagtattgcaatagagcatgtgcaaagcctagtgtg
cttttaaagcatatccgctcccacactggagagcgaccctatccctgtgtgacttgtgga
ttttcatttaagactaaaagtaatctgtataagcacaagaaatcccacgcacatactatc
aaactgggtcttgtcttgcaaccagatgctggtggcttgttcttgtcccacgagtccccc
aaagcacttagtattcattcagacgtagaagacagtggggagagcgaggaggaaggcgcc
actgatgagagacagcatgacctgggcgccatggagctgcagcctgtgcacataataaag
aggatgtcaaatgctgaaactttactaaaatcaagcttcactccaagcagtccagaaaat
gtgataggtgactttttgctacaggacagatctgcagaatcacaagctgtgacagagtta
ccgaaagttgtggtccaccatgtcactgtgtcccccttaagaactgacagtccaaaggcc
atggatcccaagcctgaactttctagtgcacaaaagcagaaggaccttcaggtgacaaac
gtacagccactttcagccaacatgtcccagggtggagtctccaggttggagactaatgag
aattcccaccagaaaggcgacatgaatccactggaaggaaagcaagactctcacgtagga
acggtacacgcccagctacaaaggcagcaggctaccgattactcccaagagcagcaagga
aagctcctgagtcctcgaagtttaggaagtacggattctggttacttttcacgttctgaa
agtgccgatcaaacagtgagtccaccaactccctttgccagaaggttacccagcacagaa
caagactctggaaggagtaacggaccctctgcagctcttgtcaccacgtcaacaccctct
gctttgcccacaggggaaaaggcattgcttttaccaggtcagatgcgcccacctttggcc
acaaaaacacttgaggagcggatatcgaagcttatctcagacaatgaagctttggtagat
gacaagcaactggatagtgtgaagccgcggagaacctcactgtcaagacgaggaagcatt
gattcccccaaatcatacatatttaaagattctttccagtttgatttaaaaccagtggga
cggagaacaagttcaagctctgatataccgaagtcacctttcacccctactgaaaaatca
aagcaagtgtttcttctgtctgtaccttcacttgactgtttacctatcacaagaagtaat
tccatgccgaccacaggttattcagcagtacctgcaaatataatacctcctcctcatcca
ctaagaggaagtcagtcatttgatgacaaaattggcgctttctatgatgatgtctttgta
tcgggacctaacgctcctgtgccccagagtgggcatccccgtacacttgtgagacaagca
gccatagaagactcttcagcaaatgaaagtcatgttcttggtactggacagtccctggat
gagagccaccaaggatgccatgctgctggtgaagccatgtcagtgaggagcaaggcactg
gcacaaggcccacatatagaaaaaaagaagtctcatcaagggcgagggacaatgtttgag
tgtgaaacttgtagaaacaggtataggaaactggaaaattttgaaaatcataagaaattt
tactgttctgagttacatggaccaaaaacaaaggtagccatgagagaacctgagcacagc
cctgtgcccggcggtctgcagcctcagattctacactacagagtcgctgggtcctccggc
atctgggaacagacgccccagataagaaaaaggaggaaaatgaaaagtgttggggatgat
gaagaacttcagcaaaatgaaagtggaacatctccaaaaagttctgaaggccttcagttt
cagaatgctctgggctgtaatcccagtttgcctaaacataatgttaccataagaagtgac
cagcagcataaaaatatacagttgcaaaactcccatattcaccttgttgccaggggccct
gagcagaccatggatcccaagctgtcgaccatcatggaacaacagataagttcagcagcc
caggacaagatagaactgcagagacacggaactggaatctctgtcatccagcacaccaac
tccctgagcaggcccaactcatttgacaagcctgagccttttgaaagagcctccccagtt
tctttccaggagctgaatagaacggggaagtccgggtctctaaaagtgataggaatctcc
caagaggaaagtcacccttctcgggacgggtctcatcctcaccagcttgcactatcagac
gctctcagaggagaacttcaggaaagctccagaaagagtccaagtgaacgacatgtgtta
ggacagccctcaagacttgtccggcagcacaacatccaagttccagagattttggtcaca
gaagaaccagatcgagacctggaagctcaatgccatgatcaagaaaagtcagagaagttc
agttggccccagcgtagtgaaaccttgtcaaaattgccaacagagaaactgccacccaaa
aagaaaaggctccgtctggctgagatagaacattcctcaacagaatcgagctttgattcc
actctctccaggagtctaagtagggagagcagtttatctcacacttcaagtttctcagcc
tctttagacatagaggacgtttctaaaacggaggcttcccccaaaatcgattttctaaat
aaagccgagtttcttatgattccagctggcttgaatactctgaatgttcctggatgtcac
cgggaaatgaggcgtactgcatcagaacagattaattgcacgcaaacgtcaatggaggtc
tctgatctcagaagcaaatcattcgattgtggaagcatcaccccaccccagacaacacca
cttactgaattgcagcctccatcttcaccttctcgagtgggagtgactgggcatgtgcct
ctcttagaaagaaggagaggcccactggtacggcaaatatctttaaacatagccccagat
agtcatctgtctcctgtacacccaacatctttccaaaatactgctcttcccagtgtgaat
gcagtgccatatcaggggcctcagctcactagtacatctttagctgagttttctgcaaat
actttgcactctcagactcaggttaaggatctgcaggcagaaacatcaaactccagctct
accaacgtttttcctgttcaacagctctgtgatatcaatttgttaaatcaaatccatgca
ccgcctagccaccagagcacacagctatctctgcaagtgtctacgcagggtagcaagcca
gataaaaattctgttttatctgggtcttctaaaagtgaggattgctttgctcccaaatac
caattgcattgtcaggttttcacttcaggcccatcttgctcttctaatcctgtgcattct
ttgccaaatcaagttatttcagatccagttggaacagatcattgtgtgacatcagcaaca
ttaccaaccaaattaattgacagcatgtctaattcgcatcctctgctaccaccagagctc
aggccccttggaagtcaggtgcagaaggtgccatcatcattcatgctgcccatacgcctg
cagagtagtgttcctgcttactgttttgctacactcacatccctgccacaaatactagtg
acccaagatctgcccaatcagccaatttgccagactaatcatagtgtagtgccaatcagt
gaagaacaaaattctgtgccaacattacaaaaaggtcatcagaatgctttgccaaaccca
gagaaggaatttctatgtgaaaatgttttttcagagatgagccaaaattcttctctatca
gaatccttgcccataactcagaaaatatctgttggtcgactttcccctcaacaagaatct
tcagcttcgagtaaaaggatgctttccccagcaaatagtttagacattgccatggaaaag
caccagaagcgggccaaagatgaaaatggagctgtttgtgcaacagacgtgagaccttta
gaggctttgagttcgagagttaatgaagctagtaaacagaagaagcctattttagtgaga
caggtttgtactacagagcccctggacggtgtgatgttggaaaaggatgttttttctcaa
cctgaaattagtaatgaggctgttaatttgacaaatgttttaccagctgataattcatca
acaggatgctctaaatttgtcgttatagaacctataagtgaattgcaggaatttgaaaac
atcaagtcatccacatcattaactcttacagttcgaagttcacctgctccttcagaaaat
actcatatttctcctttgaaatgtacagacaataaccaagaaaggaagtctccaggggtt
aaaaatcaaggtgacaaagtgaacatccaagagcaaagtcaacagccagtcacttctctt
tcattgtttaacatcaaggacacccagcagctggctttccctagcctgaaaactacaacc
aactttacatggtgttatctcttaaggcagaagtcgttgcatttgcctcagaaggaccag
aaaacttcagcctatactgattggacagtaagcgccagtaatccaaatccactcggtttg
cccacaaaagttgcacttgctctccttaattcaaaacagaacactggaaaatcactatac
tgtcaagcaataactacccattccaagtcagacttattggtctattcaagcaagtggaaa
agcagcttaagcaagagagcattaggtaatcaaaagtccacagtagttgaattcagcaat
aaagatgcctctgaaattaacagtgagcaagataaagaaaattccttaatcaaaagtgaa
ccaagaagaattaaaatatttgatggaggatataagtcaaatgaagagtatgtatatgtc
cgaggcaggggaagaggaaaatacatttgtgaagaatgtggaatacgttgtaagaaacct
agcatgttaaagaaacacatacgaacccatacagatgtccgcccctaccactgcacttac
tgtaacttctcctttaagactaaaggaaatctgacaaaacacatgaagtccaaggcacat
agcaagaaatgtgtggatttaggcgtctcagtaggtttaatagatgaacaggatacagaa
gaatcagatgaaaaacagagattcagttatgagcgatctggatatgatcttgaagaatct
gatggcccagatgaggatgacaatgaaaatgaagacgatgatgaggacagccaggctgaa
tcagtcctgtcagccacaccctcagtcacagctagcccgcagcaccttccatctagaagt
agccttcaggaccctgtgagtactgacgaggatgtcaggatcaccgattgcttttctggg
gtacacacggacccaatggacgttctgcccagggcgctgctcaccagaatgactgtcctg
agcacagcacagtctgactacaataggaagacactctctccggggaaggccaggcagcgt
gctgcgagagatgaaaacgacacaattccgtctgtagacacttccaggtccccgtgtcat
cagatgtctgtggactaccctgagtcagaagaaattctgagaagttctatggcaggaaaa
gctgttgctataacacagagcccatcatctgtaagacttcctcctgctgcagctgagcac
agcccccagacagcagcggggatgccttctgtggcctcaccacatcctgaccctcaagaa
cagaagcagcaaataactctacagccgactccaggcttgccttctccccacactcatttg
tttagccaccttcctttgcattcccagcagcaatcgaggacaccttataatatggttcca
gttggggggatccatgtggtacctgctggcctcacatactccacgtttgtgccccttcag
gctggaccagtgcagctcacgatccctgctgtcagtgtcgttcacagaactttgggtact
cataggaatacggtcacagaagtgtctggcactacaaaccctgctggagtggctgaatta
agcagtgttgtgccatgtattcctatcggccaaatccgcgtgccaggccttcagaaccta
agtaccccaggcttgcagtcactcccctcgttaagcatggaaaccgtcaatattgtaggc
ctagccaatacaaatatggccccacaagtccatccaccaggactggctctgaatgctgtc
ggactgcaggttctgactgcaaacccttcatcacaaagcagccccgcccctcaggcacac
attccaggtctccagatcttgaacatagcattgcccaccttaatcccctcagtcagtcaa
gtagccgttgatgcacagggagctccagaaatgccagcttcccaaagcaaagcatgcgag
acacaacccaagcagacttctgtagccagcgcaaaccaggtcagcaggaccgagtctcct
caggggttacctacagtccagcgggaaaatgcaaaaaaagttctgaatccacctgcccct
gcaggtgaccatgcaaggcttgatggcctgagtaaaatggacacagagaaggctgcctcg
gcaaatcacgtgaagcccaagcctgaactcacttccatacagggccaaccagcgtccacg
tcacaacctctgctgaaggcacattctgaagtttttacaaagccctcaggccagcagact
ctctctccagacagacaggttcccaggcccacagcactaccgcggaggcagcccactgtg
cacttcagcgacgtgagcagcgatgatgacgaggacaggcttgtgatagcaacctga

DBGET integrated database retrieval system