KEGG   Homo sapiens (human): 31Help
Entry
31                CDS       T01001                                 

Gene name
ACACA, ACAC, ACACAD, ACC, ACC1, ACCA
Definition
(RefSeq) acetyl-CoA carboxylase alpha
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
Module
hsa_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    31 (ACACA)
   00640 Propanoate metabolism
    31 (ACACA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    31 (ACACA)
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    31 (ACACA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    31 (ACACA)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    31 (ACACA)
   04922 Glucagon signaling pathway
    31 (ACACA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     31 (ACACA)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     31 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     31 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Leuk-A4-hydro_C MetallophosN
Motif
Other DBs
NCBI-GeneID: 31
NCBI-ProteinID: NP_942133
OMIM: 200350
HGNC: 84
Ensembl: ENSG00000278540
Vega: OTTHUMG00000188463
Pharos: Q13085(Tchem)
UniProt: Q13085
Structure
PDB: 

Position
17q12
AA seq 2346 aa AA seqDB search
MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLS
DLGISSLQDGLALHIRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQA
AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
GVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYA
EIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQ
STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSD
MNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
SFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSP
PQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLV
DHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQ
LELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFE
YLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYG
SRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQA
YGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQA
FLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVI
GNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVD
PEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGS
GMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGR
EVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPID
RIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGG
IPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPL
MVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSI
NPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAE
RKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLR
RLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE
EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILST
MDSPST
NT seq 7041 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaccatctcccttggcccaacctctggagctgaaccagcactctcgattcata
ataggttctgtgtctgaagataactcagaggatgagatcagcaacctggtgaagttggac
ctactggaggagaaggagggctccttgtcacctgcttctgttggctcagatacactctct
gatttggggatctctagcctacaggatggcttggccttgcacataaggtccagcatgtct
ggcttgcacctagtaaagcagggccgagacagaaagaaaatagattctcaacgagatttc
actgtggcttctccagcagaatttgttactcgctttgggggaaataaagtgattgagaag
gttcttattgctaacaatggcattgcagcagtgaaatgcatgcggtctatccgtaggtgg
tcttatgaaatgtttcgaaatgaacgtgcaattagattcgttgtcatggtcacacctgaa
gaccttaaagccaatgcagaatacattaagatggcagatcactatgtgccagtgcctgga
ggaccaaacaacaacaactatgcaaatgtggaattaattcttgatattgctaaaaggatc
ccagtacaagcagtgtgggctggctggggtcatgcttctgagaatcccaaactaccggaa
cttctcttgaaaaatggcattgccttcatgggtcctccaagccaggccatgtgggcttta
ggggataagattgcatcttccatagtggctcaaactgcaggtatcccaactcttccctgg
agcggcagtggtcttcgtgtggactggcaggaaaatgatttttcaaaacgtatcttaaat
gttccccaggagctatatgaaaaaggttatgtgaaagatgtggatgatgggctacaggca
gctgaggaagttggatatccagtaatgatcaaggcctcagagggaggaggagggaaggga
attagaaaagtcaacaatgcagatgacttccctaatctcttcagacaggttcaagctgaa
gttcctggatctcccatatttgtgatgagactagccaaacaatctcgtcatctggaggtg
cagatcttagcggaccaatatggcaatgctatctctttgtttggtcgtgattgctctgta
caacgcaggcatcagaagattattgaagaagcacctgctactattgctactccagcagta
tttgaacacatggaacagtgtgcggtgaaacttgccaaaatggtgggttatgtgagtgct
gggactgtggaatacctgtacagccaggatggcagcttctactttctggaattgaatcct
cggctgcaggtagagcacccttgtacagagatggtggctgatgtcaatctccctgcagca
cagctccagattgccatggggattcctctatatagaatcaaggatatccgtatgatgtat
ggggtatctccctggggtgattctcccattgattttgaagattctgcacacgttccttgt
ccaaggggccatgttattgctgctcggatcactagtgaaaatccagatgagggttttaag
cccagctcaggaacagttcaggagctaaatttccgcagcaataagaatgtttggggatat
ttcagtgttgctgctgcagggggacttcatgaatttgctgattctcagtttggtcactgc
ttttcttggggagaaaacagagaagaggcaatttcaaacatggtggtggctttgaaggag
ctgtctattcggggtgactttcgaactacagttgaatacctgatcaaattgttagagact
gaaagctttcagatgaacagaattgatactggctggctggacagactgatagcagaaaaa
gtacaggctgagcgacctgacaccatgttgggggttgtgtgtggtgccctccacgtggca
gatgtgagcctgcggaatagcgtctctaacttccttcactccttagaaaggggtcaagtc
cttcctgctcatacacttctgaatacagtagatgttgaacttatctatgagggagtcaag
tatgtacttaaggtgactcgacagtcccccaactcctatgtggtgatcatgaatggctca
tgtgtagaagtagatgtacatcggctgagtgacggtggactgctcttgtcctatgatggc
agcagttatactacgtatatgaaagaggaagtggatagatatcgcatcacaattggcaat
aaaacctgtgtgtttgagaaggaaaatgacccatcggtgatgcgctcaccttctgctggg
aagttaatccagtacattgtagaagatggaggtcatgtgtttgccggccagtgctatgct
gagattgaggtaatgaagatggtaatgaccttaacagctgtggagtctggctgtatccat
tacgtcaagcgacctggagcagctcttgaccctggctgtgtactagccaaaatgcaactg
gacaaccccagcaaggttcagcaggctgaacttcacacaggtagtctgccacggatccag
agcacggcactcagaggcgagaaactccatcgagtgttccattatgtcctggataatctg
gtcaatgtaatgaatggatactgccttccagatcctttctttagcagcaaggtaaaagac
tgggtagagcgattgatgaaaaccctcagagatccctccctgcctctcctagaattgcaa
gatattatgaccagtgtgtctggccgcattccccccaatgtggagaagtctatcaagaag
gaaatggctcagtatgctagcaacatcacatcagtcctctgtcagtttcccagccagcag
attgcaaacatcctagatagccatgcagctacattgaaccggaaatctgaacgggaagtc
ttctttatgaatactcagagcattgttcagctggtacagaggtaccgaagtggcatccga
ggccacatgaaggctgtggtgatggatctgctccggcagtacctgcgagtagagacacaa
ttccagaatggtcactatgacaaatgtgtattcgccctccgagaagagaataaaagtgac
atgaacactgtactgaactacatcttctctcacgctcaagtcaccaagaagaatcttctg
gtcacaatgcttattgatcagttgtgtggccgggaccctactctcactgatgagctgctg
aatattctcacagagctaactcaactcagtaagaccaccaatgccaaagtagcacttcga
gcacgccaggttcttattgcctcccatttgccatcatatgagcttcgccataaccaagta
gagtctatcttcctatcagctattgacatgtatggacatcaattttgcattgagaacctg
cagaaactcatcctatcagaaacatctatttttgatgtcctaccaaacttcttctatcac
agcaaccaagtagtgaggatggcagctctggaggtgtatgttcgaagggcttatattgcc
tatgaacttaacagcgtacaacaccgccagcttaaggacaacacctgtgtggtggaattc
cagttcatgctgcccacatctcatccaaacagagggaacatccctacgctaaacagaatg
tccttctcctccaacctcaaccactatggcatgacccatgtagctagtgtcagcgatgta
ctgttggacaactcattcactccaccttgtcagcggatgggcggaatggtctcttttcgg
acttttgaagattttgtcaggatctttgatgaagtgatgggctgcttctctgactcccca
ccccagagtcccacattccctgaggcaggtcacacgtctctttatgatgaggataaggtt
cccagggatgaaccaattcacattctcaatgtggctatcaagactgactgtgatattgag
gatgacaggctggcagctatgttcagagaatttacccagcaaaataaagctaccctggtt
gaccatgggatccggcgccttactttcctggttgcacaaaaggatttcagaaagcaggtc
aactatgaggtggatcggagatttcatagagaattccctaaattttttacattccgagca
agggataagtttgaggaggatcgtatctatcgtcatctggagcctgctctggctttccag
ttagagctgaaccggatgagaaattttgacctcactgccattccatgtgctaatcacaag
atgcacctgtatctcggggcagccaaggtggaagtgggcacagaagtgacagactacagg
ttctttgttcgtgcaatcatcaggcattctgatctggtcaccaaggaagcttcttttgaa
tatctgcaaaatgaaggggagcggctactcctggaagccatggatgagttggaagttgct
tttaacaatacaaatgtccgcactgactgtaaccacatcttcctcaactttgtgcccacg
gttatcatggacccatcaaagattgaggaatccgtgcggagcatggtaatgcggtatgga
agtcgcctgtggaaattgcgcgtcctccaggcagaactgaaaatcaacattcgcctgacg
ccaactggaaaagcaattcccatccgcctcttcctgacaaacgagtctggctattacttg
gatatcagcctatacaaggaagtgactgactccaggacagcacagatcatgtttcaggca
tatggagacaaacagggaccactgcatggaatgttaatcaatactccatatgtgaccaaa
gacctgctgcaatcaaagaggttccaggcacaatccttagggacaacatacatatatgat
atcccagagatgtttcggcagtccctgatcaaactctgggagtctatgtccactcaagca
tttcttccatctccccctctgccttctgacatgctgacttacactgaactggtactggat
gatcaaggtcagctggtccacatgaacaggcttccaggaggaaatgagattggcatggta
gcttggaaaatgacctttaaaagtcctgaatatccagaaggccgagatatcattgttatt
ggcaatgacatcacataccgaattgggtcctttgggcctcaagaggatttgttatttctc
agagcttccgaacttgctagggcagaaggtattccacgcatctatgtatcagccaacagt
ggagcaagaatcggactggcagaagaaattcgccatatgtttcatgtggcctgggtagat
cctgaggatccttacaagggatacaggtatttatatctgactcctcaagattataagaga
gtcagtgctctcaactctgtccattgtgaacacgtggaagatgaaggagaatccaggtac
aagataacagatattattgggaaagaagagggaattggacccgagaaccttcgaggttct
ggaatgattgctggagaatcctcattggcctataatgagatcattaccatcagcctggtg
acgtgccgggccattgggattggggcttaccttgtccggctgggacagagaaccatccag
gttgagaattctcacttaattctaacaggagctggagccctcaacaaagtcctcgggcgg
gaagtgtacacctccaataaccagctggggggcatccagattatgcacaacaatggggtg
acccactgcactgtgtgtgatgactttgaaggggttttcactgtcctgcactggctgtct
tacatgcccaagagcgtgcacagttcagttcctcttctgaactcaaaggatcctatagac
agaatcatcgagtttgttcccacaaagaccccatacgatcctcgatggatgctagcaggc
cgtcctcacccaacccaaaaaggtcagtggttgagtggcttttttgactatggatctttc
tcagagattatgcagccctgggcacagactgtggtggttggtagagccaggctaggagga
atacctgtgggagttgttgctgtagaaacccgaacagtagaactaagtatcccagctgat
ccagcaaacctggattctgaagccaagataatccagcaggctggccaggtttggttccca
gattctgcgtttaagacgtatcaggccatcaaggacttcaaccgggaagggctgcctctg
atggtctttgccaactggagaggcttctctggtggaatgaaagatatgtacgaccaagtg
ctgaagtttggtgcttacattgtggatggcttgagggagtgctgccagcctgtgctggtt
tacattcctccccaggctgagctgcggggtggctcctgggtggtgattgactcctccatc
aacccccggcacatggagatgtatgctgaccgagaaagcaggggatctgttctggagcca
gaagggacagtagaaatcaaattccgcagaaaggatctggtgaaaaccatgcgtcgggtg
gacccagtctacatccacttggctgagcgattggggaccccagagctaagcacagctgag
cggaaggagttggagaacaagttgaaggagcgggaggaattcctaattcccatttaccat
caggtagccgtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggt
gttattagcgatatcctggattggaaaacatcccgtaccttcttctactggcggctgagg
cgtcttctgctggaggacctggtcaagaagaaaatccacaatgccaaccctgagctgact
gatggccagattcaagccatgttaaggcgctggtttgtggaagtggaaggaacagtgaag
gcttatgtttgggacaataataaggatctggcggagtggctagagaaacagctgacagag
gaggatggtgttcactcggtaatagaggaaaacatcaaatgcatcagcagagactacgtc
ctcaagcaaatccgcagcttggtccaggccaatccagaggttgccatggattccatcatc
catatgacgcagcacatatcacccactcagcgagcagaagtcatacggatcctctccaca
atggattccccttccacgtag

KEGG   Homo sapiens (human): 32Help
Entry
32                CDS       T01001                                 

Gene name
ACACB, ACC2, ACCB, HACC275
Definition
(RefSeq) acetyl-CoA carboxylase beta
  KO
K01946  acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    32 (ACACB)
   00640 Propanoate metabolism
    32 (ACACB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    32 (ACACB)
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    32 (ACACB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    32 (ACACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    32 (ACACB)
   04922 Glucagon signaling pathway
    32 (ACACB)
   04920 Adipocytokine signaling pathway
    32 (ACACB)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    32 (ACACB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     32 (ACACB)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     32 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     32 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Dala_Dala_lig_C ATP-grasp_3 GxGYxYP_N
Motif
Other DBs
NCBI-GeneID: 32
NCBI-ProteinID: NP_001084
OMIM: 601557
HGNC: 85
Ensembl: ENSG00000076555
Vega: OTTHUMG00000169250
Pharos: O00763(Tchem)
UniProt: O00763
Structure
PDB: 

Position
12q24.11
AA seq 2458 aa AA seqDB search
MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQR
NGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
GTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSSDEDSV
AGSSRESTRKGSRASLGALSLEAYLTTGEAETRVPTMRPSMSGLHLVKRGREHKKLDLHR
DFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKL
PELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK
RISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQV
QSEIPGSPIFLMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAP
LAIFEFMEQCAIRLAKTVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNL
PAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPISFETPSNPPLARGHVIAARITSENPDE
GFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQFGHCFSWGENREEAISNMVVA
LKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPDIMLGVVCGAL
NVADAMFRTCMTDFLHSLERGQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIM
NGCHIEIDAHRLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSP
SAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQERGRVKYIKRPGAVLEAGCVVAR
LELDDPSKVHPAEPFTGELPAQQTLPILGEKLHQVFHSVLENLTNVMSGFCLPEPVFSIK
LKEWVQKLMMTLRHPSLPLLELQEIMTSVAGRIPAPVEKSVRRVMAQYASNITSVLCQFP
SQQIATILDCHAATLQRKADREVFFINTQSIVQLVQRYRSGIRGYMKTVVLDLLRRYLRV
EHHFQQAHYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSD
ELISILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSAIDMYGHQFCP
ENLKKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRQLPDGTCV
VEFQFMLPSSHPNRMTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTR
NFDEVISCFANVPKDTPLFSEARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVP
ILRTFVQSKKNILVDYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQL
ELNRMRNFDLTAVPCANHKMHLYLGAAKVKEGVEVTDHRFFIRAIIRHSDLITKEASFEY
LQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEESVRYMVMRYGS
RLWKLRVLQAEVKINIRQTTTGSAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSF
GNKQGPQHGMLINTPYVTKDLLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPK
DILTYTELVLDSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIG
SFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFK
YLYLTPQDYTRISSLNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSL
AYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQL
GGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSR
APYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE
TRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAVKDFNREKLPLMIFANWRGF
SGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYA
DKESRGGVLEPEGTVEIKFRKKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRKDLEGRLK
AREDLLLPIYHQVAVQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVK
QEILQASGELSHVHIQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQAGDGPRSTIR
ENITYLKHDSVLKTIRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLSTMDSPAST
NT seq 7377 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcttctttgtctatcttgtctgattttctcctgtctgaccttttcctggtta
aaaatctgggggaaaatgacggactccaagccgatcaccaagagtaaatcagaagcaaac
ctcatcccgagccaggagccctttccagcctctgataactcaggggagacaccgcagaga
aatggggagggccacactctgcccaagacacccagccaggccgagccagcctcccacaaa
ggccccaaagatgccggtcggcggagaaactccctaccaccctcccaccagaagccccca
agaaaccccctttcttccagtgacgcagcaccctccccagagcttcaagccaacgggact
gggacacaaggtctggaggccacagataccaatggcctgtcctcctcagccaggccccag
ggccagcaagctggctccccctccaaagaagacaagaagcaggcaaacatcaagaggcag
ctgatgaccaacttcatcctgggctcttttgatgactactcctccgacgaggactctgtt
gctggctcatctcgtgagtctacccggaagggcagccgggccagcttgggggccctgtcc
ctggaggcttatctgaccacaggtgaagctgagacccgcgtccccactatgaggccgagc
atgtcgggactccacctggtgaagaggggacgggaacacaagaagctggacctgcacaga
gactttaccgtggcttctcccgctgagtttgtcacacgctttgggggggatcgggtcatc
gagaaggtgcttattgccaacaacgggattgccgccgtgaagtgcatgcgctccatccgc
aggtgggcctatgagatgttccgcaacgagcgggccatccggtttgttgtgatggtgacc
cccgaggaccttaaggccaacgcagagtacatcaagatggcggatcattacgtccccgtc
ccaggagggcccaataacaacaactatgccaacgtggagctgattgtggacattgccaag
agaatccccgtgcaggcggtgtgggctggctggggccatgcttcagaaaaccctaaactt
ccggagctgctgtgcaagaatggagttgctttcttaggccctcccagtgaggccatgtgg
gccttaggagataagatcgcctccaccgttgtcgcccagacgctacaggtcccaaccctg
ccctggagtggaagcggcctgacagtggagtggacagaagatgatctgcagcagggaaaa
agaatcagtgtcccagaagatgtttatgacaagggttgcgtgaaagacgtagatgagggc
ttggaggcagcagaaagaattggttttccattgatgatcaaagcttctgaaggtggcgga
gggaagggaatccggaaggctgagagtgcggaggacttcccgatccttttcagacaagta
cagagtgagatcccaggctcgcccatctttctcatgaagctggcccagcacgcccgtcac
ctggaagttcagatcctcgctgaccagtatgggaatgctgtgtctctgtttggtcgcgac
tgctccatccagcggcggcatcagaagatcgttgaggaagcaccggccaccatcgccccg
ctggccatattcgagttcatggagcagtgtgccatccgcctggccaagaccgtgggctat
gtgagtgcagggacagtggaatacctctatagtcaggatggcagcttccacttcttggag
ctgaatcctcgcttgcaggtggaacatccctgcacagaaatgattgctgatgttaatctg
ccggccgcccagctacagatcgccatgggcgtgccactgcaccggctgaaggatatccgg
cttctgtatggagagtcaccatggggagtgactcccatttcttttgaaaccccctcaaac
cctcccctcgcccgaggccacgtcattgccgccagaatcaccagcgaaaacccagacgag
ggttttaagccgagctccgggactgtccaggaactgaatttccggagcagcaagaacgtg
tggggttacttcagcgtggccgctactggaggcctgcacgagtttgcggattcccaattt
gggcactgcttctcctggggagagaaccgggaagaggccatttcgaacatggtggtggct
ttgaaggaactgtccatccgaggcgactttaggactaccgtggaatacctcattaacctc
ctggagaccgagagcttccagaacaacgacatcgacaccgggtggttggactacctcatt
gctgagaaagtgcaggcggagaaaccggatatcatgcttggggtggtatgcggggccttg
aacgtggccgatgcgatgttcagaacgtgcatgacagatttcttacactccctggaaagg
ggccaggtcctcccagcggattcactactgaacctcgtagatgtggaattaatttacgga
ggtgttaagtacattctcaaggtggcccggcagtctctgaccatgttcgttctcatcatg
aatggctgccacatcgagattgatgcccaccggctgaatgatggggggctcctgctctcc
tacaatgggaacagctacaccacctacatgaaggaagaggttgacagttaccgaattacc
atcggcaataagacgtgtgtgtttgagaaggagaacgatcctacagtcctgagatccccc
tcggctgggaagctgacacagtacacagtggaggatgggggccacgttgaggctgggagc
agctacgctgagatggaggtgatgaagatgatcatgaccctgaacgttcaggaaagaggc
cgggtgaagtacatcaagcgtccaggtgccgtgctggaagcaggctgcgtggtggccagg
ctggagctcgatgacccttctaaagtccacccggctgaaccgttcacaggagaactccct
gcccagcagacactgcccatcctcggagagaaactgcaccaggtcttccacagcgtcctg
gaaaacctcaccaacgtcatgagtggcttttgtctgccagagcccgtttttagcataaag
ctgaaggagtgggtgcagaagctcatgatgaccctccggcacccgtcactgccgctgctg
gagctgcaggagatcatgaccagcgtggcaggccgcatccccgcccctgtggagaagtct
gtccgcagggtgatggcccagtatgccagcaacatcacctcggtgctgtgccagttcccc
agccagcagatagccaccatcctggactgccatgcagccaccctgcagcggaaggctgat
cgagaggtcttcttcatcaacacccagagcatcgtgcagttggtccagagataccgcagc
gggatccgcggctatatgaaaacagtggtgttggatctcctgagaagatacttgcgtgtt
gagcaccattttcagcaagcccactacgacaagtgtgtgataaacctcagggagcagttc
aagccagacatgtcccaggtgctggactgcatcttctcccacgcacaggtggccaagaag
aaccagctggtgatcatgttgatcgatgagctgtgtggcccagacccttccctgtcggac
gagctgatctccatcctcaacgagctcactcagctgagcaaaagcgagcactgcaaagtg
gccctcagagcccggcagatcctgattgcctcccacctcccctcctacgagctgcggcat
aaccaggtggagtccattttcctgtctgccattgacatgtacggccaccagttctgcccc
gagaacctcaagaaattaatactttcggaaacaaccatcttcgacgtcctgcctactttc
ttctatcacgcaaacaaagtcgtgtgcatggcgtccttggaggtttacgtgcggaggggc
tacatcgcctatgagttaaacagcctgcagcaccggcagctcccggacggcacctgcgtg
gtagaattccagttcatgctgccgtcctcccacccaaaccggatgaccgtgcccatcagc
atcaccaaccctgacctgctgaggcacagcacagagctcttcatggacagcggcttctcc
ccactgtgccagcgcatgggagccatggtagccttcaggagattcgaggacttcaccaga
aattttgatgaagtcatctcttgcttcgccaacgtgcccaaagacacccccctcttcagc
gaggcccgcacctccctatactccgaggatgactgcaagagcctcagagaagagcccatc
cacattctgaatgtgtccatccagtgtgcagaccacctggaggatgaggcactggtgccg
attttacggacattcgtacagtccaagaaaaatatccttgtggattatggactccgacga
atcacattcttgattgcccaagagaaagaatttcccaagtttttcacattcagagcaaga
gatgagtttgcagaagatcgcatttaccgtcacttggaacctgccctggccttccagctg
gaacttaaccggatgcgtaacttcgatctgaccgccgtgccctgtgccaaccacaagatg
cacctttacctgggtgctgccaaggtgaaggaaggtgtggaagtgacggaccataggttc
ttcatccgcgccatcatcaggcactctgacctgatcacaaaggaagcctccttcgaatac
ctgcagaacgagggtgagcggctgctcctggaggccatggacgagctggaggtggcgttc
aataacaccagcgtgcgcaccgactgcaaccacatcttcctcaacttcgtgcccactgtc
atcatggaccccttcaagatcgaggagtccgtgcgctacatggttatgcgctacggcagc
cggctgtggaaactccgtgtgctacaggctgaggtcaagatcaacatccgccagaccacc
accggcagtgccgttcccatccgcctgttcatcaccaatgagtcgggctactacctggac
atcagcctctacaaagaagtgactgactccagatctggaaatatcatgtttcactccttc
ggcaacaagcaagggccccagcacgggatgctgatcaatactccctacgtcaccaaggat
ctgctccaggccaagcgattccaggcccagaccctgggaaccacctacatctatgacttc
ccggaaatgttcaggcaggctctctttaaactgtggggctccccagacaagtatcccaaa
gacatcctgacatacactgaattagtgttggactctcagggccagctggtggagatgaac
cgacttcctggtggaaatgaggtgggcatggtggccttcaaaatgaggtttaagacccag
gagtacccggaaggacgggatgtgatcgtcatcggcaatgacatcacctttcgcattgga
tcctttggccctggagaggaccttctgtacctgcgggcatccgagatggcccgggcagag
ggcattcccaaaatttacgtggcagccaacagtggcgcccgtattggcatggcagaggag
atcaaacacatgttccacgtggcttgggtggacccagaagacccccacaaaggatttaaa
tacctgtacctgactccccaagactacaccagaatcagctccctgaactccgtccactgt
aaacacatcgaggaaggaggagagtccagatacatgatcacggatatcatcgggaaggat
gatggcttgggcgtggagaatctgaggggctcaggcatgattgctggggagtcctctctg
gcttacgaagagatcgtcaccattagcttggtgacctgccgagccattgggattggggcc
tacttggtgaggctgggccagcgagtgatccaggtggagaattcccacatcatcctcaca
ggagcaagtgctctcaacaaggtcctgggaagagaggtctacacatccaacaaccagctg
ggtggcgttcagatcatgcattacaatggtgtctcccacatcaccgtgccagatgacttt
gagggggtttataccatcctggagtggctgtcctatatgccaaaggataatcacagccct
gtccctatcatcacacccactgaccccattgacagagaaattgaattcctcccatccaga
gctccctacgacccccggtggatgcttgcaggaaggcctcacccaactctgaagggaacg
tggcagagcggattctttgaccacggcagtttcaaggaaatcatggcaccctgggcgcag
accgtggtgacaggacgagcaaggcttggggggattcccgtgggagtgattgctgtggag
acacggactgtggaggtggcagtccctgcagaccctgccaacctggattctgaggccaag
ataattcagcaggcaggacaggtgtggttcccagactcagcctacaaaaccgcccaggcc
gtcaaggacttcaaccgggagaagttgcccctgatgatctttgccaactggagggggttc
tccggtggcatgaaagacatgtatgaccaggtgctgaagtttggagcctacatcgtggac
ggccttagacaatacaaacagcccatcctgatctatatcccgccctatgcggagctccgg
ggaggctcctgggtggtcatagatgccaccatcaacccgctgtgcatagaaatgtatgca
gacaaagagagcaggggtggtgttctggaaccagaggggacagtggagattaagttccga
aagaaagatctgataaagtccatgagaaggatcgatccagcttacaagaagctcatggaa
cagctaggggaacctgatctctccgacaaggaccgaaaggacctggagggccggctaaag
gctcgcgaggacctgctgctccccatctaccaccaggtggcggtgcagttcgccgacttc
catgacacacccggccggatgctggagaagggcgtcatatctgacatcctggagtggaag
accgcacgcaccttcctgtattggcgtctgcgccgcctcctcctggaggaccaggtcaag
caggagatcctgcaggccagcggggagctgagtcacgtgcatatccagtccatgctgcgt
cgctggttcgtggagacggagggggctgtcaaggcctacttgtgggacaacaaccaggtg
gttgtgcagtggctggaacagcactggcaggcaggggatggcccgcgctccaccatccgt
gagaacatcacgtacctgaagcacgactctgtcctcaagaccatccgaggcctggttgaa
gaaaaccccgaggtggccgtggactgtgtgatatacctgagccagcacatcagcccagct
gagcgggcgcaggtcgttcacctgctgtctaccatggacagcccggcctccacctga

DBGET integrated database retrieval system