KEGG   Homo sapiens (human): 3119Help
Entry
3119              CDS       T01001                                 

Gene name
HLA-DQB1, CELIAC1, HLA-DQB, IDDM1
Definition
(RefSeq) major histocompatibility complex, class II, DQ beta 1
  KO
K06752  major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  HTLV-I infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Disease
H00079  Asthma
H00080  Systemic lupus erythematosus
H00081  Hashimoto's thyroiditis
H00082  Graves disease
H00294  Dilated cardiomyopathy (DCM)
H00295  Viral myocarditis
H00342  Tuberculosis
H00408  Type I diabetes mellitus
H01362  Dermatitis herpetiformis
H01490  Multiple sclerosis
H01492  Systemic sclerosis
H02123  Celiac disease
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3119 (HLA-DQB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3119 (HLA-DQB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3119 (HLA-DQB1)
   04612 Antigen processing and presentation
    3119 (HLA-DQB1)
   04658 Th1 and Th2 cell differentiation
    3119 (HLA-DQB1)
   04659 Th17 cell differentiation
    3119 (HLA-DQB1)
   04672 Intestinal immune network for IgA production
    3119 (HLA-DQB1)
 09160 Human Diseases
  09162 Immune diseases
   05310 Asthma
    3119 (HLA-DQB1)
   05322 Systemic lupus erythematosus
    3119 (HLA-DQB1)
   05323 Rheumatoid arthritis
    3119 (HLA-DQB1)
   05320 Autoimmune thyroid disease
    3119 (HLA-DQB1)
   05321 Inflammatiory bowel disease (IBD)
    3119 (HLA-DQB1)
   05330 Allograft rejection
    3119 (HLA-DQB1)
   05332 Graft-versus-host disease
    3119 (HLA-DQB1)
  09165 Cardiovascular diseases
   05416 Viral myocarditis
    3119 (HLA-DQB1)
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3119 (HLA-DQB1)
  09167 Infectious diseases
   05150 Staphylococcus aureus infection
    3119 (HLA-DQB1)
   05152 Tuberculosis
    3119 (HLA-DQB1)
   05166 HTLV-I infection
    3119 (HLA-DQB1)
   05164 Influenza A
    3119 (HLA-DQB1)
   05168 Herpes simplex infection
    3119 (HLA-DQB1)
   05169 Epstein-Barr virus infection
    3119 (HLA-DQB1)
   05145 Toxoplasmosis
    3119 (HLA-DQB1)
   05140 Leishmaniasis
    3119 (HLA-DQB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3119 (HLA-DQB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3119 (HLA-DQB1)
  Exosomal proteins of epithelial cells
   3119 (HLA-DQB1)
  Exosomal proteins of breast milk
   3119 (HLA-DQB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 3119
NCBI-ProteinID: NP_001230891
OMIM: 604305
HGNC: 4944
Ensembl: ENSG00000179344
Vega: OTTHUMG00000031124
Pharos: P01920(Tbio)
UniProt: P01920 Q5Y7D3
Structure
PDB: 

Position
6p21.32
AA seq 261 aa AA seqDB search
MSWKKALRIPGGLRAATVTLMLSMLSTPVAEGRDSPEDFVYQFKGMCYFTNGTERVRLVS
RSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELR
TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaaaaaggctttgcggatccccggaggccttcgggcagcaactgtgaccttg
atgctgtcgatgctgagcaccccagtggctgagggcagagactctcccgaggatttcgtg
taccagtttaagggcatgtgctacttcaccaacgggacagagcgcgtgcgtcttgtgagc
agaagcatctataaccgagaagagatcgtgcgcttcgacagcgacgtgggggagttccgg
gcggtgacgctgctggggctgcctgccgccgagtactggaacagccagaaggacatcctg
gagaggaaacgggcggcggtggacagggtgtgcagacacaactaccagttggagctccgc
acgaccttgcagcggcgagtggagcccacagtgaccatctccccatccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccagcccagatcaaa
gtccggtggtttcggaatgaccaggaggagacagctggcgttgtgtccaccccccttatt
aggaatggtgactggaccttccagatcctggtgatgctggaaatgactccccagcgtgga
gacgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcaatctgaatctgcccagagcaagatgctgagtggcattggaggcttcgtgctg
gggctgatcttcctcgggctgggccttatcatccatcacaggagtcagaaagggctcctg
cactga

DBGET integrated database retrieval system