KEGG   Homo sapiens (human): 3120Help
Entry
3120              CDS       T01001                                 

Gene name
HLA-DQB2, DQB2, HLA-DQB1, HLA-DXB
Definition
(RefSeq) major histocompatibility complex, class II, DQ beta 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 Ig_2 ig MHC_I I-set
Motif
Other DBs
NCBI-GeneID: 3120
NCBI-ProteinID: NP_001185787
OMIM: 615161
HGNC: 4945
Ensembl: ENSG00000232629
Vega: OTTHUMG00000031125
Pharos: P05538(Tbio)
UniProt: P05538
Position
6p21.32
AA seq 227 aa AA seqDB search
MALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIY
NREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQR
QVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDW
TFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcagatccctggaggcttttgggcagcagctgtgaccgtgatgctggtgatg
ctgagcaccccagtggctgaggccagagactttcccaaggatttcttggtccagtttaag
ggcatgtgctacttcaccaacgggacagagcgcgtgcgcggtgtggccagatacatctat
aaccgcgaggagtacgggcgcttcgacagcgacgttggggagttccaggcggtgaccgag
ctggggcggagcatcgaggactggaacaactataaggacttcttggagcaggagcgggcc
gcggtggacaaggtgtgcagacacaactacgaggcggagctgcgcacgaccttgcagcgg
caagtggagcccacagtgaccatctccccatccaggacagaggccctcaaccaccacaac
ctgctggtctgctcggtgacagatttctatccagcccagatcaaagtccggtggtttcgg
aatgaccaggaggagacagccggtgttgtgtccacctccctcattaggaatggtgactgg
accttccagattctggtgatgctggaaataactccccagcgtggagacatctacacctgc
caagtggagcaccccagcctccagagccccatcaccgtggagtggcgacctcgagggcct
ccaccagcaggactcctgcactga

DBGET integrated database retrieval system