KEGG   Homo sapiens (human): 3122Help
Entry
3122              CDS       T01001                                 

Gene name
HLA-DRA, HLA-DRA1
Definition
(RefSeq) major histocompatibility complex, class II, DR alpha
  KO
K06752  major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
N00508  HTLV-1 Tax to NFY-mediated transcription
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3122 (HLA-DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3122 (HLA-DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3122 (HLA-DRA)
   04612 Antigen processing and presentation
    3122 (HLA-DRA)
   04658 Th1 and Th2 cell differentiation
    3122 (HLA-DRA)
   04659 Th17 cell differentiation
    3122 (HLA-DRA)
   04672 Intestinal immune network for IgA production
    3122 (HLA-DRA)
 09160 Human Diseases
  09163 Immune diseases
   05310 Asthma
    3122 (HLA-DRA)
   05322 Systemic lupus erythematosus
    3122 (HLA-DRA)
   05323 Rheumatoid arthritis
    3122 (HLA-DRA)
   05320 Autoimmune thyroid disease
    3122 (HLA-DRA)
   05321 Inflammatory bowel disease (IBD)
    3122 (HLA-DRA)
   05330 Allograft rejection
    3122 (HLA-DRA)
   05332 Graft-versus-host disease
    3122 (HLA-DRA)
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    3122 (HLA-DRA)
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3122 (HLA-DRA)
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    3122 (HLA-DRA)
   05152 Tuberculosis
    3122 (HLA-DRA)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    3122 (HLA-DRA)
   05164 Influenza A
    3122 (HLA-DRA)
   05168 Herpes simplex infection
    3122 (HLA-DRA)
   05169 Epstein-Barr virus infection
    3122 (HLA-DRA)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    3122 (HLA-DRA)
   05140 Leishmaniasis
    3122 (HLA-DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3122 (HLA-DRA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3122 (HLA-DRA)
  Exosomal proteins of epithelial cells
   3122 (HLA-DRA)
  Exosomal proteins of breast milk
   3122 (HLA-DRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Motif
Other DBs
NCBI-GeneID: 3122
NCBI-ProteinID: NP_061984
OMIM: 142860
HGNC: 4947
Ensembl: ENSG00000204287
Vega: OTTHUMG00000031269
Pharos: P01903(Tbio)
UniProt: P01903 A0A0G2JMH6
Structure
PDB: 

Position
6p21.32
AA seq 254 aa AA seqDB search
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GLRKSNAAERRGPL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccataagtggagtccctgtgctaggatttttcatcatagctgtgctgatgagcgct
caggaatcatgggctatcaaagaagaacatgtgatcatccaggccgagttctatctgaat
cctgaccaatcaggcgagtttatgtttgactttgatggtgatgagattttccatgtggat
atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag
gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag
cgctccaactatactccgatcaccaatgtacctccagaggtaactgtgctcacaaacagc
cctgtggaactgagagagcccaacgtcctcatctgtttcatagacaagttcaccccacca
gtggtcaatgtcacgtggcttcgaaatggaaaacctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc
tcaactgaggacgtttacgactgcagggtggagcactggggcttggatgagcctcttctc
aagcactgggagtttgatgctccaagccctctcccagagactacagagaacgtggtgtgt
gccctgggcctgactgtgggtctggtgggcatcattattgggaccatcttcatcatcaag
ggattgcgcaaaagcaatgcagcagaacgcagggggcctctgtaa

DBGET integrated database retrieval system