KEGG   Homo sapiens (human): 3122
Entry
3122              CDS       T01001                                 

Symbol
HLA-DRA, HLA-DRA1
Name
(RefSeq) major histocompatibility complex, class II, DR alpha
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3122 (HLA-DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3122 (HLA-DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3122 (HLA-DRA)
   04612 Antigen processing and presentation
    3122 (HLA-DRA)
   04658 Th1 and Th2 cell differentiation
    3122 (HLA-DRA)
   04659 Th17 cell differentiation
    3122 (HLA-DRA)
   04672 Intestinal immune network for IgA production
    3122 (HLA-DRA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3122 (HLA-DRA)
   05164 Influenza A
    3122 (HLA-DRA)
   05168 Herpes simplex virus 1 infection
    3122 (HLA-DRA)
   05169 Epstein-Barr virus infection
    3122 (HLA-DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3122 (HLA-DRA)
   05152 Tuberculosis
    3122 (HLA-DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3122 (HLA-DRA)
   05140 Leishmaniasis
    3122 (HLA-DRA)
  09163 Immune disease
   05310 Asthma
    3122 (HLA-DRA)
   05322 Systemic lupus erythematosus
    3122 (HLA-DRA)
   05323 Rheumatoid arthritis
    3122 (HLA-DRA)
   05320 Autoimmune thyroid disease
    3122 (HLA-DRA)
   05321 Inflammatory bowel disease
    3122 (HLA-DRA)
   05330 Allograft rejection
    3122 (HLA-DRA)
   05332 Graft-versus-host disease
    3122 (HLA-DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3122 (HLA-DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3122 (HLA-DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3122 (HLA-DRA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3122 (HLA-DRA)
  Exosomal proteins of epithelial cells
   3122 (HLA-DRA)
  Exosomal proteins of breast milk
   3122 (HLA-DRA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 3122
NCBI-ProteinID: NP_061984
OMIM: 142860
HGNC: 4947
Ensembl: ENSG00000204287
Vega: OTTHUMG00000031269
Pharos: P01903(Tbio)
UniProt: P01903 A0A0G2JMH6
Structure
PDB: 

Position
6p21.32
AA seq 254 aa
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GLRKSNAAERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataagtggagtccctgtgctaggatttttcatcatagctgtgctgatgagcgct
caggaatcatgggctatcaaagaagaacatgtgatcatccaggccgagttctatctgaat
cctgaccaatcaggcgagtttatgtttgactttgatggtgatgagattttccatgtggat
atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag
gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag
cgctccaactatactccgatcaccaatgtacctccagaggtaactgtgctcacaaacagc
cctgtggaactgagagagcccaacgtcctcatctgtttcatagacaagttcaccccacca
gtggtcaatgtcacgtggcttcgaaatggaaaacctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc
tcaactgaggacgtttacgactgcagggtggagcactggggcttggatgagcctcttctc
aagcactgggagtttgatgctccaagccctctcccagagactacagagaacgtggtgtgt
gccctgggcctgactgtgggtctggtgggcatcattattgggaccatcttcatcatcaag
ggattgcgcaaaagcaatgcagcagaacgcagggggcctctgtaa

KEGG   Homo sapiens (human): 3123
Entry
3123              CDS       T01001                                 

Symbol
HLA-DRB1, DRB1, HLA-DR1B, HLA-DRB, SS1
Name
(RefSeq) major histocompatibility complex, class II, DR beta 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00079  Asthma
H00080  Systemic lupus erythematosus
H00081  Hashimoto thyroiditis
H00082  Graves disease
H00294  Dilated cardiomyopathy
H00342  Tuberculosis
H00408  Type 1 diabetes mellitus
H01468  Eosinophilic granulomatosis with polyangiitis
H01490  Multiple sclerosis
H01492  Systemic sclerosis
H01502  Sjogren syndrome
H01504  Vogt-Koyanagi-Harada syndrome
H01516  Adult onset Still disease
H01698  Giant cell arteritis
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3123 (HLA-DRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3123 (HLA-DRB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3123 (HLA-DRB1)
   04612 Antigen processing and presentation
    3123 (HLA-DRB1)
   04658 Th1 and Th2 cell differentiation
    3123 (HLA-DRB1)
   04659 Th17 cell differentiation
    3123 (HLA-DRB1)
   04672 Intestinal immune network for IgA production
    3123 (HLA-DRB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3123 (HLA-DRB1)
   05164 Influenza A
    3123 (HLA-DRB1)
   05168 Herpes simplex virus 1 infection
    3123 (HLA-DRB1)
   05169 Epstein-Barr virus infection
    3123 (HLA-DRB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3123 (HLA-DRB1)
   05152 Tuberculosis
    3123 (HLA-DRB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3123 (HLA-DRB1)
   05140 Leishmaniasis
    3123 (HLA-DRB1)
  09163 Immune disease
   05310 Asthma
    3123 (HLA-DRB1)
   05322 Systemic lupus erythematosus
    3123 (HLA-DRB1)
   05323 Rheumatoid arthritis
    3123 (HLA-DRB1)
   05320 Autoimmune thyroid disease
    3123 (HLA-DRB1)
   05321 Inflammatory bowel disease
    3123 (HLA-DRB1)
   05330 Allograft rejection
    3123 (HLA-DRB1)
   05332 Graft-versus-host disease
    3123 (HLA-DRB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3123 (HLA-DRB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3123 (HLA-DRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3123 (HLA-DRB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3123 (HLA-DRB1)
  Exosomal proteins of epithelial cells
   3123 (HLA-DRB1)
  Exosomal proteins of breast milk
   3123 (HLA-DRB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2 I-set DUF202
Other DBs
NCBI-GeneID: 3123
NCBI-ProteinID: NP_001230894
OMIM: 142857
HGNC: 4948
Ensembl: ENSG00000196126
Vega: OTTHUMG00000031196
Pharos: P01912(Tbio)
UniProt: P01911 Q5Y7D1
Structure
PDB: 
6ATF 6ATI 6ATZ 1A6A

Position
6p21.32
AA seq 266 aa
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYF
HNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTV
QRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPRGFLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaggctccctggaggctcctgcatggcagttctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacaccagaccacgtttcttggagtactct
acgtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc
cataaccaggaggagaacgtgcgcttcgacagcgacgtgggggagttccgggcggtgacg
gagctggggcggcctgatgccgagtactggaacagccagaaggacctcctggagcagaag
cggggccgggtggacaactactgcagacacaactacggggttgtggagagcttcacagtg
cagcggcgagtccatcctaaggtgactgtgtatccttcaaagacccagcccctgcagcac
cataacctcctggtctgttctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttccggaatggccaggaagagaagactggggtggtgtccacaggcctgatccacaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcacccaagcgtgacaagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaagaggattcctgagctga

KEGG   Homo sapiens (human): 3125
Entry
3125              CDS       T01001                                 

Symbol
HLA-DRB3, DRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B, HLA-DRB3*
Name
(RefSeq) major histocompatibility complex, class II, DR beta 3
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3125 (HLA-DRB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3125 (HLA-DRB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3125 (HLA-DRB3)
   04612 Antigen processing and presentation
    3125 (HLA-DRB3)
   04658 Th1 and Th2 cell differentiation
    3125 (HLA-DRB3)
   04659 Th17 cell differentiation
    3125 (HLA-DRB3)
   04672 Intestinal immune network for IgA production
    3125 (HLA-DRB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3125 (HLA-DRB3)
   05164 Influenza A
    3125 (HLA-DRB3)
   05168 Herpes simplex virus 1 infection
    3125 (HLA-DRB3)
   05169 Epstein-Barr virus infection
    3125 (HLA-DRB3)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3125 (HLA-DRB3)
   05152 Tuberculosis
    3125 (HLA-DRB3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3125 (HLA-DRB3)
   05140 Leishmaniasis
    3125 (HLA-DRB3)
  09163 Immune disease
   05310 Asthma
    3125 (HLA-DRB3)
   05322 Systemic lupus erythematosus
    3125 (HLA-DRB3)
   05323 Rheumatoid arthritis
    3125 (HLA-DRB3)
   05320 Autoimmune thyroid disease
    3125 (HLA-DRB3)
   05321 Inflammatory bowel disease
    3125 (HLA-DRB3)
   05330 Allograft rejection
    3125 (HLA-DRB3)
   05332 Graft-versus-host disease
    3125 (HLA-DRB3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3125 (HLA-DRB3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3125 (HLA-DRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3125 (HLA-DRB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3125 (HLA-DRB3)
  Exosomal proteins of epithelial cells
   3125 (HLA-DRB3)
  Exosomal proteins of breast milk
   3125 (HLA-DRB3)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 I-set DUF202 C2-set_2
Other DBs
NCBI-GeneID: 3125
NCBI-ProteinID: NP_072049
OMIM: 612735
HGNC: 4951
Pharos: P79483(Tchem)
UniProt: P79483 A0A4D6G1L1
Structure
PDB: 
3C5J 2Q6W 4H1L

Position
6p21.3
AA seq 266 aa
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYF
HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV
QRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctccagcttggcagcgttgacagtgacactgatg
gtgctgagctcccgactggctttcgctggggacacccgaccacgtttcttggagctgcgt
aagtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc
cataaccaggaggagttcctgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgtcgccgagtcctggaacagccagaaggacctcctggagcagaag
cggggccgggtggacaattactgcagacacaactacggggttggtgagagcttcacagtg
cagcggcgagtccatcctcaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacgggcctgatccagaatgga
gactggaccttccagaccctggtgatgctagaaacagttcctcggagtggagaggtttac
acttgccaagtggagcacccaagcgtaacgagcgctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggattcctgagctga

KEGG   Homo sapiens (human): 3126
Entry
3126              CDS       T01001                                 

Symbol
HLA-DRB4, DR4, DRB4, HLA-DR4B, HLA-DRB4*
Name
(RefSeq) major histocompatibility complex, class II, DR beta 4
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H01468  Eosinophilic granulomatosis with polyangiitis
H01504  Vogt-Koyanagi-Harada syndrome
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3126 (HLA-DRB4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3126 (HLA-DRB4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3126 (HLA-DRB4)
   04612 Antigen processing and presentation
    3126 (HLA-DRB4)
   04658 Th1 and Th2 cell differentiation
    3126 (HLA-DRB4)
   04659 Th17 cell differentiation
    3126 (HLA-DRB4)
   04672 Intestinal immune network for IgA production
    3126 (HLA-DRB4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3126 (HLA-DRB4)
   05164 Influenza A
    3126 (HLA-DRB4)
   05168 Herpes simplex virus 1 infection
    3126 (HLA-DRB4)
   05169 Epstein-Barr virus infection
    3126 (HLA-DRB4)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3126 (HLA-DRB4)
   05152 Tuberculosis
    3126 (HLA-DRB4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3126 (HLA-DRB4)
   05140 Leishmaniasis
    3126 (HLA-DRB4)
  09163 Immune disease
   05310 Asthma
    3126 (HLA-DRB4)
   05322 Systemic lupus erythematosus
    3126 (HLA-DRB4)
   05323 Rheumatoid arthritis
    3126 (HLA-DRB4)
   05320 Autoimmune thyroid disease
    3126 (HLA-DRB4)
   05321 Inflammatory bowel disease
    3126 (HLA-DRB4)
   05330 Allograft rejection
    3126 (HLA-DRB4)
   05332 Graft-versus-host disease
    3126 (HLA-DRB4)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3126 (HLA-DRB4)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3126 (HLA-DRB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3126 (HLA-DRB4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3126 (HLA-DRB4)
  Exosomal proteins of epithelial cells
   3126 (HLA-DRB4)
  Exosomal proteins of breast milk
   3126 (HLA-DRB4)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202
Other DBs
NCBI-GeneID: 3126
NCBI-ProteinID: NP_068818
HGNC: 4952
Pharos: P13762(Tdark)
UniProt: P13762 X5D2U9
Position
6p21.3
AA seq 266 aa
MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYI
YNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTV
QRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLL
FLGTGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctcctgtatggcagcgctgacagtgacattgacg
gtgctgagctccccactggctttggctggggacacccaaccacgtttcttggagcaggct
aagtgtgagtgtcatttcctcaatgggacggagcgagtgtggaacctgatcagatacatc
tataaccaagaggagtacgcgcgctacaacagtgacctgggggagtaccaggcggtgacg
gagctggggcggcctgacgctgagtactggaacagccagaaggacctcctggagcggagg
cgggccgaggtggacacctactgcagatacaactacggggttgtggagagcttcacagtg
cagcggcgagtccaacctaaggtgactgtgtatccttcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcatccaagcatgatgagccctctcacggtgcaatggagtgcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttgggacagggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggactcttgagctga

KEGG   Homo sapiens (human): 3127
Entry
3127              CDS       T01001                                 

Symbol
HLA-DRB5, HLA-DRB5*
Name
(RefSeq) major histocompatibility complex, class II, DR beta 5
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H02424  Primary central nervous system lymphoma
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3127 (HLA-DRB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3127 (HLA-DRB5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3127 (HLA-DRB5)
   04612 Antigen processing and presentation
    3127 (HLA-DRB5)
   04658 Th1 and Th2 cell differentiation
    3127 (HLA-DRB5)
   04659 Th17 cell differentiation
    3127 (HLA-DRB5)
   04672 Intestinal immune network for IgA production
    3127 (HLA-DRB5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3127 (HLA-DRB5)
   05164 Influenza A
    3127 (HLA-DRB5)
   05168 Herpes simplex virus 1 infection
    3127 (HLA-DRB5)
   05169 Epstein-Barr virus infection
    3127 (HLA-DRB5)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3127 (HLA-DRB5)
   05152 Tuberculosis
    3127 (HLA-DRB5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3127 (HLA-DRB5)
   05140 Leishmaniasis
    3127 (HLA-DRB5)
  09163 Immune disease
   05310 Asthma
    3127 (HLA-DRB5)
   05322 Systemic lupus erythematosus
    3127 (HLA-DRB5)
   05323 Rheumatoid arthritis
    3127 (HLA-DRB5)
   05320 Autoimmune thyroid disease
    3127 (HLA-DRB5)
   05321 Inflammatory bowel disease
    3127 (HLA-DRB5)
   05330 Allograft rejection
    3127 (HLA-DRB5)
   05332 Graft-versus-host disease
    3127 (HLA-DRB5)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3127 (HLA-DRB5)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3127 (HLA-DRB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3127 (HLA-DRB5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3127 (HLA-DRB5)
  Exosomal proteins of epithelial cells
   3127 (HLA-DRB5)
  Exosomal proteins of breast milk
   3127 (HLA-DRB5)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig
Other DBs
NCBI-GeneID: 3127
NCBI-ProteinID: NP_002116
OMIM: 604776
HGNC: 4953
Ensembl: ENSG00000198502
Vega: OTTHUMG00000031027
Pharos: Q30154(Tbio)
UniProt: Q30154 A0A2Z4LKS3
Structure
PDB: 
1FV1 1ZGL 1HQR 1H15

Position
6p21.32
AA seq 266 aa
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDI
YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFKNQKGHSGLHPTGLVS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggttcctacatggcaaagctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacacccgaccacgtttcttgcagcaggat
aagtatgagtgtcatttcttcaacgggacggagcgggtgcggttcctgcacagagacatc
tataaccaagaggaggacttgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgacgctgagtactggaacagccagaaggacttcctggaagacagg
cgcgccgcggtggacacctactgcagacacaactacggggttggtgagagcttcacagtg
cagcggcgagttgagcctaaggtgactgtgtatcctgcaaggacccagaccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg
ttccggaacagccaggaagagaaggctggggtggtgtccacaggcctgattcagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcgaagtggagaggtttac
acctgccaagtggagcacccaagcgtgacgagccctctcacagtggaatggagagcacag
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctattcatctacttcaagaatcagaaagggcactctggacttcac
ccaacaggactcgtgagctga

DBGET integrated database retrieval system