KEGG   Homo sapiens (human): 3126Help
Entry
3126              CDS       T01001                                 

Gene name
HLA-DRB4, DR4, DRB4, HLA-DR4B
Definition
(RefSeq) major histocompatibility complex, class II, DR beta 4
  KO
K06752  major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  HTLV-I infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Disease
H01468  Eosinophilic granulomatosis with polyangiitis
H01504  Vogt-Koyanagi-Harada syndrome
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3126 (HLA-DRB4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3126 (HLA-DRB4)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3126 (HLA-DRB4)
   04612 Antigen processing and presentation
    3126 (HLA-DRB4)
   04658 Th1 and Th2 cell differentiation
    3126 (HLA-DRB4)
   04659 Th17 cell differentiation
    3126 (HLA-DRB4)
   04672 Intestinal immune network for IgA production
    3126 (HLA-DRB4)
 Human Diseases
  Immune diseases
   05310 Asthma
    3126 (HLA-DRB4)
   05322 Systemic lupus erythematosus
    3126 (HLA-DRB4)
   05323 Rheumatoid arthritis
    3126 (HLA-DRB4)
   05320 Autoimmune thyroid disease
    3126 (HLA-DRB4)
   05321 Inflammatiory bowel disease (IBD)
    3126 (HLA-DRB4)
   05330 Allograft rejection
    3126 (HLA-DRB4)
   05332 Graft-versus-host disease
    3126 (HLA-DRB4)
  Cardiovascular diseases
   05416 Viral myocarditis
    3126 (HLA-DRB4)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3126 (HLA-DRB4)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3126 (HLA-DRB4)
   05152 Tuberculosis
    3126 (HLA-DRB4)
   05166 HTLV-I infection
    3126 (HLA-DRB4)
   05164 Influenza A
    3126 (HLA-DRB4)
   05168 Herpes simplex infection
    3126 (HLA-DRB4)
   05169 Epstein-Barr virus infection
    3126 (HLA-DRB4)
   05145 Toxoplasmosis
    3126 (HLA-DRB4)
   05140 Leishmaniasis
    3126 (HLA-DRB4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3126 (HLA-DRB4)
  Exosomal proteins of epithelial cells
   3126 (HLA-DRB4)
  Exosomal proteins of breast milk
   3126 (HLA-DRB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202
Motif
Other DBs
NCBI-GeneID: 3126
NCBI-ProteinID: NP_068818
HGNC: 4952
Pharos: P13762(Tdark)
UniProt: P13762 X5D2U9
Position
6p21.3
AA seq 266 aa AA seqDB search
MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYI
YNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTV
QRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLL
FLGTGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctcctgtatggcagcgctgacagtgacattgacg
gtgctgagctccccactggctttggctggggacacccaaccacgtttcttggagcaggct
aagtgtgagtgtcatttcctcaatgggacggagcgagtgtggaacctgatcagatacatc
tataaccaagaggagtacgcgcgctacaacagtgacctgggggagtaccaggcggtgacg
gagctggggcggcctgacgctgagtactggaacagccagaaggacctcctggagcggagg
cgggccgaggtggacacctactgcagatacaactacggggttgtggagagcttcacagtg
cagcggcgagtccaacctaaggtgactgtgtatccttcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcatccaagcatgatgagccctctcacggtgcaatggagtgcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttgggacagggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggactcttgagctga

DBGET integrated database retrieval system